KEGG   Giardia lamblia: GL50803_14855Help
Entry
GL50803_14855     CDS       T01047                                 

Definition
Phosphoinositide-3-kinase, catalytic, alpha polypeptide
Orthology
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
gla  Giardia lamblia
Pathway
Inositol phosphate metabolism
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:gla00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    GL50803_14855
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    GL50803_14855
Enzymes [BR:gla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     GL50803_14855
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 2155 aa AA seqDB search
MQVSIISPKGAICTFCTRPDVAIVALEFESRCRLGLEDTPILLQYTSKSATFTNELSTLG
ECLANLNVVSVDSLQFHVLPLDLASTPNHYTSEPETVFDLLESWQYHKLDTILLSFTILH
YQSLVAEALVSKKNKLMITAHTQPDISPSHPFLTSPLARDLATKVTSAILRAIPTHNQNK
SVDLGIFQQEIADWIAMDLRAQLSFSVIEQHVLNASSCSSAHSLPPRQERLLPGKEGSLP
DSQVSSLHKLGPCGVKNNSGIDHTHMNPSHNTILIENLQRRIDESGACAHLDWEVVTASL
DGVENPLGVSPASPLVPLNPISYPHFTLVFSFPEDTTDRRPAISRSWCISDEHRASLDKT
TAITVDAQQSLSSNLENTITISPLLTCDEACCIVYEYASSQYGSQRLDLALRVTRPYDLV
IKQRGTSAYLVGMDYLINYDSVRVCLKKAEPLYVTLANRKEFEKAMSDTLLGHTFENIIF
NFNFKLFLQDCNPTKSTLIHAGTSSASEPSVGTPPLFDDQILGTFGSIVHKKDVMNLEFQ
PLLRSPAKSIASRETCNSPASSIDLMRSSNCTKQADDAEAERLESTPFESLTPVIPKIHA
ESAAKGIGRANSFLKSPTLAPLRTNSEENASICAESYSWDPKLQPLPLPPGNRFYDDYVE
YYSFLSSSTFDLLIQKRCAEYAKDPLSFYTRYCGSVKGVVRRCPLRFAPLTQLMKRKIVP
DKQSMNQSHFLPSKKHSTATVRSPEELTIVDIRTLDEELSVRLLDVSLPLSSFPKENISK
FKSTKWGTRPYNVIDYAMHIDPRYTARVEADWLAELLRILCFSDQKLSTTDSSGPMNRLS
TPVHRAERRGSDAQFNGMIQNLKYILADIDQLLADLGASPIFEEAFYSVEQSILSHDNSL
TKSLDCKSSEEFQRGPQKLPEDTTPLKERVSLDLHLADLTVPPPPITDTADEISFKRQCK
RTSVKDTSQVDPAESLLVSSKASQDILKINTTYVFTTVAQIHVGTEPISDKAFAGYAALE
FSEVKKAEVVCKLHYDTTLSFKNFLTKFLPFGAQIVFTVYAVNKKSLGRLIQAANVTNQL
FSQSYIKLLNEKQSSILQSSNQSVSTMFIETYDGLLADSSTLILGSVSVPFFDSSGALSR
RVYEVPLWPGTDASDVLSMLLFRPYTRGAMRISFEFPIKSTEKVIKSLKFSPMVISTDPY
KPPTEETLVMASSNVSIPSGQNSRSSSKTRSASNKRSTSRSYSTRGRGASRRRNACNTIV
DKDAPVIFSEFNPLSLIGATAHMEAEEVNKPFNTFISSRPKSSKSRTRQSIFKDKKDDRR
AKQSPFSRRTQSKVRVSNRSSFSSQKDGDDRSSFSGIALSSSYTKHNPASLHRDSAYDAT
YDVPEDDGISKNYGTRRSSAFSCTQAVFQRKLTTTIEYSTDNELSDTSMLPPTLKAVARR
VSSNSDDNAYNDNPEDQHNEIDVSQKRNYYLKLLCILKSYIETNNQDTHWGDYTFSVCTK
LEALSPFLTYPLTYLTKLEYQHLWEYKDLALCDPVLLFRLSQSINYKNKDSVQSFYNILS
AKKIEDVTLDTVMNLLASAQTDPIIRGFAVSVLNTYSSYDLEPHIMQLVELCKYDMVNAG
LASFLIRMAIKEFPTFGYPLYWAFRCEMRLNLVFSSAYSLFMLKILLHLPENQRRSIILT
ELLLIILLKLAKFSYRKKKESIDASKGTQLRDVPSFIGRINNLLTRLKNILKVDCFKLPL
SYDIKLATFCVVECAVLSSKKAPLLLSLKTADGAFNYKCLFKTHDDLRQDSLVLRTFSYI
QNVWYNNNINLAMKVYSCVATGPFEGLIELVPDSETLGSIEHTFGGARGAFARGPIMKWL
VDSINLHDEEFLRVQKNAQHNNSLTQEMRYSLLLEPEDDNRASETSELTISDVEQSVLNK
GYDDTNQGLFNTTASVPTTLNTRSLYSKSSRDSIFQSVSQLSLIQKHTATRYTQMISNYL
TSIAAYCVATCILGLGDRHNDNIMLCQDGTFFHIDFGHFLGNFKKKFNYERERGPFFFIP
DMAFVLKHHDYVNGTEYEKCFEKMSADALLAIRHHSSALISLFTIMIPSGIPQLTSREDV
QWIEDHLFLDMSESEAHRHFIRLIHEAERSKRYLYNNMFHILAHYKKRRGSASSN
NT seq 6468 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtttccattataagccctaagggggctatttgcactttttgcacgcgccctgac
gttgccattgtagccctagagttcgaatctcgctgccgcttagggttggaggacacccct
attctattgcagtacacgagcaaatccgcaacatttacaaatgaactgagcacactaggt
gaatgcttagctaacctaaacgtagtttcggtcgattctctccagttccacgttcttcct
ttggatttagcatcaacccccaatcactacacatctgaacctgagaccgtctttgacctg
ctagaaagctggcaatatcacaaattggacactattttgctttcatttaccatattgcac
taccaatcacttgtagcagaggctcttgtcagcaaaaagaacaagctaatgattacggca
cacacgcagcccgatatatcaccatctcacccatttctgaccagtcccttagcaagggat
ctagctacgaaagtaacctctgcaatccttcgtgcaatcccaacccataatcaaaataaa
tccgttgacttagggatctttcagcaggagattgctgactggattgccatggacttgcga
gcgcagctatcctttagtgtgattgagcaacatgtattgaatgccagctcttgctcttct
gctcacagtcttcctcccagacaagagcgattgttaccaggaaaggaaggatcactaccc
gattcccaagtatcttctctccacaagcttggaccttgtggggttaagaataattcaggc
atagaccatactcacatgaatccatcccataacactatcctcatagaaaacctgcaaaga
agaatagacgagagcggggcgtgcgctcatctggactgggaagtcgtgacggcaagtcta
gacggggttgaaaacccattaggagtatcacctgcatcgcctcttgtcccgctaaacccc
atcagttatccacactttactctggttttcagcttcccggaagatacaaccgaccgtagg
cctgccatctctcggagctggtgtatcagtgacgaacaccgagcttctctagacaaaacc
actgctattactgttgatgcccagcaatctctgtccagcaacttagagaataccatcacc
atctcgcctcttttaacatgtgacgaagcatgctgcattgtgtatgaatacgcctctagc
cagtatggatctcaaaggttggaccttgcactcagagtaacacgaccgtacgatcttgta
ataaagcaaagaggaacctctgcatatctagttgggatggattacttaatcaactatgat
agcgttagagtttgtctaaagaaagcagaacctctctatgttactttagccaaccgaaaa
gaatttgaaaaagccatgtccgacaccctgcttggccatacatttgaaaatattattttc
aacttcaattttaagctgtttctgcaggattgcaatcccactaagagtactttgattcat
gccggaaccagctctgcttctgaaccatccgttgggacaccaccactttttgatgaccaa
atactgggaactttcggttccattgtgcataagaaggatgttatgaaccttgagtttcag
cccttacttaggtctcctgccaagtcaatcgcaagtcgagagacctgcaacagccctgcc
tctagtatagatcttatgcgctcttcaaattgtactaagcaagcagatgatgcagaagcg
gagaggttagagtctactccatttgaatcgttgactccagtcattccgaaaatacatgct
gaatcagcggctaaaggcattggccgagccaatagtttcttaaaatcacctactcttgcg
ccactcagaacgaatagcgaagagaatgcaagcatctgtgctgaatcttattcgtgggac
ccaaagttgcaacctctacctttgccaccaggcaatcggttctatgatgattacgttgag
tactactcattcttgtcgtcgtctaccttcgatttgttgatccaaaagcgctgtgctgag
tatgccaaagatccactatccttttatacacgatactgtggatctgtaaagggagtcgtt
cgcaggtgccccctaagatttgcacccttgactcaattaatgaagcgaaagattgtgcca
gacaagcaatccatgaatcagtcacactttttaccaagcaaaaagcattcaactgccact
gttcgttcccctgaagagttgacaatagtggatatacgtactcttgacgaggaattatcg
gtgcgactacttgacgtgtcgcttcctctaagtagctttccaaaagagaacatttctaaa
tttaaatccaccaaatggggaacccgtccgtacaatgtcatcgattatgcaatgcatatt
gatccacgctacacagctagagtagaagcagactggctcgctgagttactacgtattctg
tgtttttcagatcaaaagctttctaccacagactccagcggaccaatgaatagactgtca
actcctgtgcacagagctgaaagaaggggatcagatgctcaattcaatggaatgatacag
aatttaaaatatattttggctgacatagatcaacttcttgctgatctgggggcatcgcca
atattcgaagaagcattctattcagtagaacagagcatactttctcacgataattccttg
accaaatcattagactgcaagagctctgaagagttccagcgtggtcctcaaaagttaccc
gaggatactactccgctcaaagagcgggtctccctagatttacacttggcagatcttact
gtcccacctccgccgatcactgacacagctgacgagatttctttcaagcggcaatgcaaa
aggacaagcgtgaaggatacttctcaagtggacccagcagagtccctccttgtttcttct
aaagcctcacaggacattcttaagatcaatacaacatacgtattcactacagtggcccaa
atccacgtcggaacagaaccaatttcagataaagcttttgctggctatgcggcccttgaa
ttcagtgaagttaagaaagcagaggttgtttgcaagctacactatgacacaactcttagt
tttaagaacttcctcaccaagttcctcccttttggtgcccaaatagtattcacagtatat
gccgtgaacaagaaatctctcggtcgtttgatacaggccgcgaatgtcactaatcagctt
ttctcgcagtcatatatcaaacttctcaatgaaaagcaatcctctattctgcaatcatcc
aaccaaagtgtgtctacgatgttcatagaaacatatgatgggctcctagccgatagttca
actctgatactaggtagtgtgagcgtaccattctttgattcttctggggctctttcacgg
cgagtgtatgaggtgccactgtggccaggaacagacgctagcgatgtccttagcatgctt
ctatttcgcccatacacacggggagctatgcgcataagctttgagtttccgataaagtcg
accgaaaaagtgatcaagtccttaaaattctcgccaatggttattagcacggatccatat
aagccacctacagaggaaacccttgtgatggcctcctcgaacgttagtattccatctgga
cagaattctaggtcatcatctaagactcgttcagcgtcaaacaagcgttcaaccagtaga
tcttactcaacgcgcggaagaggtgcatctaggcggcgaaatgcatgtaacactattgtt
gataaagatgcccctgtcatttttagcgaattcaaccccctgtcattaattggggccacc
gcacatatggaagcagaagaggttaacaagccgtttaacacttttatctcttcacggcca
aagtcaagtaaaagtcgcacaagacaaagcattttcaaagacaagaaagacgacaggcgt
gccaagcagtcaccctttagtaggcgtacgcagtccaaggtaagagtcagtaaccgtagt
tccttttcgtcacagaaagacggagatgataggtcttcgttttcagggatcgccttatcc
tcatcatatactaagcacaatcctgcctctctacacagagactctgcatatgacgctacc
tacgacgtccccgaagacgacggtatctccaagaactatggcactcggcgtagcagtgcc
ttcagctgtacccaagctgtgttccaacgtaaacttactacaacgattgagtacagcaca
gacaacgaattgtcagatacatccatgcttcccccaacgctaaaagctgttgccagaagg
gtttcctctaatagcgatgacaatgcgtacaatgacaacccagaggaccagcacaatgaa
atagacgtaagccaaaagcgaaattactacctaaagcttctctgcatcctgaagtcgtat
atcgaaaccaacaaccaagatacccactggggagattatactttttccgtctgtacaaag
ttagaggcactctctccttttctaacataccctttgacatatctgacaaaactagaatac
cagcatctgtgggaatacaaagacctagccctttgcgatcctgttctgctatttagacta
agccaatctataaactataaaaataaagattctgttcaaagtttctataacattctgtcc
gcaaagaaaatagaagacgtcacactggatactgtcatgaacctcttggctagcgctcaa
acagatccaatcataagaggttttgctgtttctgttctaaacacctattcttcttatgat
ctcgagcctcacatcatgcaactagtcgagctatgcaagtatgacatggtcaatgcgggc
ttagcatctttcctcataagaatggccattaaggagttcccaacattcggctaccctctc
tactgggcttttcgctgtgagatgcggctaaatcttgtttttagcagtgcatactctcta
ttcatgcttaaaatcttactacatctgccagaaaatcaacgaagaagcattattcttact
gaattactacttattatattacttaaactggccaagttctcctatcggaagaagaaggaa
tccatcgatgctagtaagggcacacaacttcgtgacgtgcccagctttataggacgcata
aacaacttactcacaagactaaagaacatattaaaagtggattgctttaagctgcctcta
tcttacgacataaagttggcaaccttctgtgtggttgagtgtgctgttctttctagcaag
aaggcaccgctactcctttccctgaaaacagctgacggcgctttcaactacaagtgtctt
tttaagactcacgatgacctgcggcaggacagccttgtgctccgcacattttcatatatc
caaaacgtatggtacaacaataatattaatctggcaatgaaggtatatagctgcgttgca
acagggccattcgagggtttgatagagcttgttcccgactctgaaactctggggtccata
gagcatacgtttgggggtgctaggggagcatttgcgaggggccctatcatgaagtggcta
gtggattcaataaacctccacgacgaggaatttttacgtgtacagaagaatgcacaacat
aataatagtttgacacaggagatgaggtacagcctgctattagagccagaggatgacaat
cgggcgagtgagactagtgagctgaccatctctgatgtggagcaatctgtcctgaataag
ggatacgacgacaccaatcagggcctattcaataccacagccagcgtgcctacgactctt
aacactagaagtctctactccaaatcttcacgagatagcatatttcaatccgtctctcag
ctctccctcatacagaagcatacagcaacaaggtacacccagatgatatccaactacctt
acgtcaatagcagcatactgtgtggcaacttgcattcttggtttgggcgacagacacaat
gacaatataatgctatgccaggacggtaccttttttcacatagattttggtcactttctt
ggtaattttaaaaagaagttcaactacgaaagagagcggggaccattcttcttcattcca
gatatggcttttgtgcttaagcaccatgactacgttaatggcacagagtatgagaaatgt
tttgaaaagatgtcagcagatgccctactagcaatcaggcaccacagcagcgctctgata
agcctttttacgatcatgataccctctggtatccctcagctgacatctcgggaggatgtg
caatggattgaagaccatctgttcctagatatgagtgagtccgaggcgcacagacacttc
attcggcttatccacgaggcagaacgatctaaaagatacttgtacaacaacatgtttcat
attttggctcactacaagaagcggcgaggaagcgcctcctccaactaa

DBGET integrated database retrieval system