KEGG   Giardia lamblia: GL50803_15495Help
Entry
GL50803_15495     CDS       T01047                                 

Definition
hypothetical protein
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
gla  Giardia lamblia
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:gla03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 871 aa AA seqDB search
MLTSNKEVLEAFNATFKTPEPKMVSDLSCIVIISGLPTPEASKRKRLLKYVYEHIVKKSG
DVAETEHIQIPLDANDACSGFCLIRFVNPSGAEKCVREFNGNTSIFGDDYPLTVRQYSYV
EELRKLPKSYTPQPYTPIDCSERHRRLYFPLSGRIDHEFLLLTKTNVSRCAFNGENISII
NVQPCADKLLDVSYSPMGTYFIYHYEESIVLVHDNGTTITISHESDSQDTHTFIRSFKVS
PCERFLLTFSYTANVDELDEYDLDKFLKDVDEAEDEFGLYQKFEESKHITVSVWSIIERR
ILSTLNNVKLYSYKNNDDSLVRPEDRVLFSSTGNLILLMSNEQISVYKVQLTESAIYVIS
LQEVLSYPNTTSLLFSPNGHGQDIVAIYQKSSDKQKPSVCNVLNLNVPSHGRSGVRVLAQ
RSFFITNGRLFWSANGGCLAIITESQSDQNLVSTIFVIILQGNSESVSYDRLQELAGAKG
LERKPLRRDLVVKMEQLELPQNLYIQSACWAATGSMLAFITIPVGSSKEAQEESRKYIKM
QKQSNANSLQFSLKALDSFMKHAVDEREMLLNDGQAAIYIFTLQEKYGLYPCKLGKPVYP
EIVSGEVVDHANRKAAVVKIKKIPGITASEVMFSPYNDYLVALNRNDRKEQALIVINTST
LEKTSAEIEVVDGCSWDSSGRYLIAHKYGGKSSSFGLYIINVTGMVVYQSTHASLVDNLL
NTIWRPYDQELINSCVERSLESIYKYCDENYDKLLFDKTNDSSMKERVEKNKAEWLALYE
AETLTADEQRTLNKNVRGCFVLHGLDGNLSGFDEQGNILDKSLWLENVQETVYILEEVLA
GSTIPLEHYKTMYGDADPKSATADQKPEQVE
NT seq 2616 nt NT seq  +upstreamnt  +downstreamnt
atgctaacgagcaacaaggaggtcttggaggcatttaatgccacgtttaagaccccggaa
ccaaagatggttagtgaccttagctgcatagttatcataagtggactgccgactccagag
gctagcaaaaggaagcggctcctcaaatatgtttacgagcacattgtcaagaagtctggc
gacgtggcagaaactgagcatattcagattccactggacgcaaacgacgcctgtagcggt
ttctgtcttatccggtttgttaatcccagcggcgccgagaagtgtgtcagagagtttaat
ggcaacaccagtatctttggagatgattatccgctcactgtgcgccagtatagctacgtg
gaagagctacgcaagttacccaagagctacactccgcaaccgtacacgcccatcgattgt
agtgagcgccacagacgcctctacttccctctctctggccgcatagaccatgaatttctt
ctgttgacaaagaccaatgtgagccggtgtgctttcaacggggagaatatttccattata
aacgtacaaccttgcgctgacaagcttctcgacgtcagttactcaccaatgggcacctac
ttcatataccattatgaggaaagcattgtcttggttcatgacaacggaacgaccatcacc
atttctcacgagtcggacagccaggacactcacaccttcatcaggtccttcaaggtctct
ccgtgtgagcgttttctgctgacgttttcttacacagctaacgttgatgagctggacgaa
tacgatctagacaagttcctcaaggatgtagacgaggctgaggatgaatttgggctctac
cagaagtttgaggagtcaaagcacatcaccgtatctgtctggtccattattgagcgccgt
attctctctacactgaacaatgtgaagttgtattcgtacaagaacaacgacgatagttta
gtaagacccgaggatcgtgtcttgttcagctcgactgggaacttgattttgctaatgagc
aatgagcagatatctgtctataaggttcagctaaccgagtctgcaatctatgtaataagc
ctccaagaagtcctgtcatacccgaacaccacgtcactcctattcagcccaaacggccac
ggtcaggatattgtggctatctatcagaagtcttcagacaagcaaaagccttcagtctgc
aacgtgctcaacttgaacgtccccagccacggccgttctggtgtgcgagtccttgcacag
aggtctttctttatcaccaatggccggctattctggagcgcaaatggtggttgtcttgca
attatcactgagtcccaaagcgaccaaaacttagtctctactatctttgttatcattctc
cagggaaacagtgagagtgtctcctatgatagactgcaagagcttgcgggcgcaaagggg
ctggaaaggaagcctcttcgccgggaccttgtggtaaaaatggagcagctcgagctcccc
caaaacctttacattcaaagtgcgtgctgggctgccaccggatccatgcttgctttcatt
acgattcctgttggatcatctaaagaggcccaggaagaaagccgaaagtatatcaagatg
cagaagcagagcaacgctaattccttgcagttttctctcaaggccctggactccttcatg
aagcacgccgttgatgagcgcgaaatgctcctcaatgacggacaggctgccatctacatc
ttcacgctccaggaaaagtacggactttacccctgcaagcttggcaagccagtttatcca
gagattgtttctggagaagttgtcgatcatgccaacagaaaggcagcggtcgtaaagatc
aagaagataccgggcatcacggcctcagaggtaatgttctctccttataacgactacctc
gtcgcgctgaatcgcaatgacagaaaggagcaggctctgatcgtgatcaatactagtact
ttagagaagacctctgcagagatagaggtggtagacgggtgctcctgggactcgtctgga
aggtacttgatagcccacaagtacggtggcaagtcttcatcattcggattgtacattatt
aacgtcacggggatggttgtctatcaatcaacccacgcgtctctggttgataatctcctc
aacactatatggcgaccttacgaccaagaacttatcaactcctgcgtcgagaggtctctg
gagagcatctataagtactgtgatgaaaactacgacaagctgctgtttgacaagaccaac
gatagctccatgaaggagcgagttgagaagaacaaggcagagtggcttgctctttacgag
gcagagaccttaacagccgacgaacagcgcacactcaacaagaacgtccgtggctgcttt
gtgctgcacggccttgatggaaaccttagcggattcgatgaacagggcaacattctcgac
aagagcttgtggctggagaatgtacaagagacggtttatatcctcgaggaggtgttagca
ggaagcacaattccactggaacattacaagacgatgtatggtgacgcagacccaaaaagc
gcaaccgctgaccagaaacctgagcaggtggagtaa

DBGET integrated database retrieval system