KEGG   Giardia lamblia: GL50803_15546Help
Entry
GL50803_15546     CDS       T01047                                 

Definition
hypothetical protein
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
gla  Giardia lamblia
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:gla00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    GL50803_15546
Translation factors [BR:gla03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    GL50803_15546
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 261 aa AA seqDB search
MPALDFGSSSEGSEPEAWESNAMKLSKQNEEKEIAEQKRRAEEEAARNREKIRKRERDSF
TTGAPELSETAKARLDEKRRYEQNIVAASNMLRDNDSSDDEGGKGPKNSANGDKKKNNGQ
LRDYTLEDNFMGGEIAEGVSSGPQSIEEMIPASIEQFDAFADAIVKKLVSTYKNDNDVLY
MHCLKRIVEGALSPLYHEDAKELSDVCARISVEMYRKEAEKKKKKGKAQKGGSHATGKSQ
VYVGGRDAKYQKVDDDYEDFI
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgcccgctttagactttgggtcttccagcgagggatctgagccagaggcatgggagagc
aacgccatgaagctatcaaagcaaaatgaggagaaggagatagctgagcaaaagagacgg
gcagaagaagaggccgcccgaaatcgtgagaagatccgcaagagagaacgggatagcttt
acgactggtgctcccgaactttcagaaactgcaaaagcacgcctcgatgaaaagcgtcgg
tatgaacaaaacattgtggctgcttcgaatatgttacgtgataacgacagcagtgacgat
gagggtggcaagggacctaagaactccgccaacggggacaagaagaaaaacaatggacag
ctgagggactacactcttgaagacaatttcatgggcggcgaaatcgctgagggcgtgtcc
tctgggccacagagtattgaggaaatgatccctgcgtctattgagcaattcgatgcattt
gcagatgcaatagttaaaaagcttgtctctacctacaagaacgacaatgatgttctttac
atgcattgccttaagcgcattgtcgagggcgctctttctccgctctatcacgaagatgca
aaagagctctcggacgtatgcgcacgcatttctgttgagatgtatcgtaaagaggctgaa
aagaagaaaaagaagggtaaggcccaaaagggtggctcacacgcaactggcaagtcccag
gtctacgtgggtggccgtgacgccaagtaccaaaaggtggacgacgactatgaggatttc
atttga

DBGET integrated database retrieval system