KEGG   Giardia lamblia: GL50803_15823Help
Entry
GL50803_15823     CDS       T01047                                 

Definition
1,4-alpha-glucan branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
gla  Giardia lamblia
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gla00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    GL50803_15823
Enzymes [BR:gla01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     GL50803_15823
Exosome [BR:gla04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GL50803_15823
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 783 aa AA seqDB search
MAPLVDNISGKLLKMSGRELLQVDPLLQDYVGVVESRWEDFKHMLSYISDDLGGFDSVSN
YVDYGFYVEVDDARYSLNQLSDLDDICKDVATYNGRIHLIYKEWAENAVFLSIIGDFNFW
DKAAHPGVNKGYGIWECRIPFYVNQELNMLHCPIHHKAKFKVFMVTRDKNEEIYRMPQRT
LYAVHNHERCQLEPLFYCHAADADARKREELTRPYAFKSQSPQGLRKKVHRIYECHVGMS
STEPKINTYREFADILLPIIKEKGYNVIQLMAIQEHSYYGSFGYQVTSFFAPSSRFGTPD
DLKYLVDKAHEAGIAVLLDLVHSHASKNVEDGIADWDGSTMFFYKEDHPLWDSKIFNYKN
PETLRFLLQNVRWWLQEFKIDGFRFDGVMSLMYYHRSAGVGYTGRYGEYFDEPQSAVDVG
GLTYLRLAHVLIKMIEQTEGRDILTIAEDVSGYPCMATPILDGGIGFDYRFQMAVPDLWI
NMMKHGFDTGLNDFESIDVKKITHTLTNRRWQEKHIVYCECHDQALVGDKTLSMWLLNEN
IYDQMSILHQANERTLRAIRLHKVIRLLTMGLGGEGYLTFFGNEFGHPEWIDFPRVGNSW
SYHYCRRQWNLDYWGKDGQTTRYADLGRFDRDLMHLNACHEWNVEREYITRDDNEEKLIV
FERKNLLFVCSLHPFNPDYEAIIPVRQQGTYRVIFHTNSIQYGGDESGTTEGNELVTRNK
MNKESNDLKEDQWDRKMNGLQYYIKLWIKRQCGYVLELSKGTVSIPDTVKSFEELFPKKN
PPL
NT seq 2352 nt NT seq  +upstreamnt  +downstreamnt
atggctcctcttgtagacaacatcagcgggaagctgctcaagatgtctgggagggagctt
ctgcaagtggaccctctcctgcaagactatgtgggcgttgtggaatcaaggtgggaagac
ttcaagcacatgcttagttacatttctgatgaccttggaggctttgacagcgtttcaaac
tacgttgattatggcttctacgtagaggtagatgatgcccggtacagtcttaatcaactt
tcggacctggatgacatctgtaaagatgtcgccacttacaacggccgcattcatcttatt
tacaaggagtgggcagagaacgccgtgttcttatctattataggtgacttcaatttctgg
gacaaggctgcacacccaggagtcaataaaggatacgggatctgggagtgtcggatccct
ttttacgtcaaccaggagttgaatatgcttcactgcccaattcaccataaggcaaagttc
aaggtcttcatggtgacacgtgacaagaatgaagaaatctatcgcatgccccaacgaaca
ctctatgctgttcataaccatgagaggtgtcagttggaacccttgttctattgtcacgca
gcagacgcagatgcaagaaaaagagaagagctcacacgaccatacgcattcaagtcacag
agtccacaagggttgcgcaagaaggtacacaggatttacgagtgccacgttggcatgagc
tctactgagccaaagataaatacctacagagagtttgcagacattctcctccccatcatc
aaagaaaagggctacaatgtaatacaactaatggcaatccaagagcactcttattatggg
tcgtttggttatcaggtcacgtcattctttgcccccagttcaagatttgggacgcccgac
gatctaaaataccttgtagacaaagcacatgaggcaggtattgctgttcttctcgattta
gttcactcacatgcatcgaagaacgttgaggacgggatcgcagactgggacggtagtacg
atgttcttttataaggaggaccatcccctgtgggacagcaagattttcaactacaagaac
ccggagactcttcgttttttgctccaaaatgtgcgctggtggctccaggagtttaagatc
gacggcttcaggtttgacggggtgatgtctctcatgtactatcacaggagtgcaggtgtt
gggtatacaggccgttacggagagtactttgacgagccccaatcagcggttgatgttggt
ggactaacatacttgcgattggctcatgtcctcattaagatgattgagcagactgaaggc
cgtgacatcctgacaatagcagaggacgtctcaggctacccgtgcatggcgacaccaata
ctagatgggggtataggatttgactatcgttttcaaatggctgtcccagatctgtggatc
aacatgatgaaacatggctttgacacaggtctcaatgacttcgaaagtattgatgtcaaa
aaaataacgcacacactcacaaaccgtaggtggcaagagaagcatatcgtctattgtgag
tgccacgatcaggctctggttggtgacaagacattgagcatgtggctactaaacgagaat
atatatgatcagatgagtattctgcaccaggcaaatgaaagaactctacgtgcgatccgt
ctccacaaagttattcgtctgttaacgatgggtcttggaggtgagggatacctcactttc
tttggcaatgaattcggacacccagaatggattgactttccacgcgtaggtaatagctgg
agctaccattactgtcgaaggcagtggaacctcgactattgggggaaggacggtcaaaca
acacgctatgcagacctcggccgatttgacagggatcttatgcacctcaatgcctgccat
gaatggaacgtggaaagggaatatattacccgtgatgataacgaggagaagctcatagtt
ttcgagcggaagaatcttctttttgtatgcagccttcacccctttaaccctgactatgag
gccattatacctgttcgtcaacagggaacatatcgagttatcttccacacaaatagtatt
caatatggaggagatgaatcggggaccacggaagggaatgaactggtaacacgcaacaag
atgaataaagaaagtaatgacttaaaggaagatcagtgggatagaaagatgaatgggttg
caatattacattaaattatggataaagcgccaatgtggctatgttcttgagctttctaag
gggactgtctccattccagatactgttaagagctttgaggagctatttcccaagaagaat
ccaccattatag

DBGET integrated database retrieval system