KEGG   Giardia lamblia: GL50803_16090Help
Entry
GL50803_16090     CDS       T01047                                 

Definition
Ubiquitin carboxyl-terminal hydrolase 4 (EC:3.1.2.15)
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.4.19.12]
Organism
gla  Giardia lamblia
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:gla00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    GL50803_16090
Enzymes [BR:gla01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     GL50803_16090
Peptidases [BR:gla01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   GL50803_16090
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 439 aa AA seqDB search
MEPAVDSVDRDKRGEWGDPTQDVSRVGHVGLLNLGNTCFMNSGLQVLLSSKHLIGAIMKL
REREQSDFNGTRVNGREMQDAFQNLIDASRGNMTDIYRPDKIKDAASRLNKSFRGYGQQD
SFELIQTVLDGLEKETNKAKEVPYKLLDTDGMGYSKAQELFREHHHMKYDSPITKVTCTE
LAKCVMCTKCRAKSYSFSYCQALLLDLPIKESRTEVKKTKKDEKQDRGSGNRLSLSALIN
NSEKVYTVDNYYCAKCKTHQRVHVREWISEPAKCLIIQLKRFRNEGHSVLPRFLWRYSKN
DSSVEYEDTLEIQSLEFEQDGVEKDDMQPDRAYSGSEVDSSADPTVWETPLHDDSSSEHV
VQGMIATALDAKAPHVRSYKYRYRGASLHSGGLGGGHYTALCYGCNDKYYYCNDSSVTVV
DRGKLDTRAYVLLFDRVDC
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggagcctgctgtggattctgttgaccgcgataaacggggtgagtggggtgatcccacg
caggacgttagccgtgttggccatgttggcctcttaaatctaggtaatacctgtttcatg
aacagtggactccaggttcttttgtcaagcaaacaccttataggggcgattatgaaactg
agagaacgagaacagagcgatttcaatgggacccgtgtcaacggcagggaaatgcaagat
gcctttcagaaccttattgatgcatcaagaggcaacatgacagacatttacaggcctgat
aagataaaagacgctgcatcaagactgaataaatccttcagggggtatggacagcaagat
tcatttgaacttattcaaacagtcctggatggattggagaaggagacaaataaagcaaag
gaggtaccatacaaattgctagacacagatggaatggggtacagcaaggcacaagagctg
tttcgagagcaccaccacatgaagtacgactcgccaatcacgaaggtcacatgcacggag
cttgccaagtgcgtcatgtgcacgaagtgccgcgccaaatcatactccttttcctactgt
caagcacttctcttggacctgcccatcaaggaaagtagaactgaagtgaagaaaacgaaa
aaggacgaaaaacaggatcggggtagtggtaatagattgagtctcagtgcactcatcaat
aactcagaaaaagtatacactgtggacaactactactgtgcaaagtgcaagactcaccag
cgcgtacatgtacgggaatggatatccgagccagccaagtgtcttatcattcagctcaaa
cgcttcagaaacgagggacacagtgtgcttcctcggtttctctggagatacagtaagaac
gactcgtccgtcgagtacgaggacacgctggagatacaatccctcgagtttgagcaagat
ggtgtcgaaaaagatgacatgcagcctgacagggcatattcaggatctgaggtggactcc
agtgcagatccgactgtctgggagaccccgttgcatgacgatagtagtagtgagcacgta
gtgcaaggaatgatagccacggcactagacgctaaggcaccgcatgtcagaagctacaaa
taccggtaccgaggggcatctttgcactctggaggtctgggcggcggacactacacagca
ctctgctacggctgcaacgacaagtactactactgcaacgactcgagcgtcacagtagtg
gacagaggaaagttggacacccgtgcatatgtgcttctgtttgacagggtggattgctag

DBGET integrated database retrieval system