KEGG   Giardia lamblia: GL50803_16639Help
Entry
GL50803_16639     CDS       T01047                                 

Definition
Histone acetyltransferase Elp3
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
gla  Giardia lamblia
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 588 aa AA seqDB search
MNKYQLQQIMLDSAVVNAILEILKAINDKAGVVEQKDVTRASALVARQYSLPQAPSVADI
ASSLPAAQKLELSSYLVRKPIRSASGVQVIAVMCKPHRCPHQVRTGASCTYCGGGPDSDF
AYSTQSYTGFEPTSMRAIRARYDPTEQVRVRMEQLRQLGHTTNKIEVVLMGGTFLSTPRS
YRDSFISGIYTGLTGHIPAGPKRNIVPESISYAARSSIKCVALTIETRPDYCEPRHLADM
LRYGTTRLEIGVQSVYDDVCGDINRGHTVRSVIRCFGQSKDAGFKMIAHMMPNLPFTSTF
RDIFGFQELFQSTNYRPDGLKIYPTLIIRGTELYERWRLNKYLRNLPTHKLIYLLTIIYV
LAPPWVRIYRIMRDIPLPLISAGVDSSNLRELALASLARSETQSLEIRQRESGIVEAASN
EMTKKSLYTQDGGNARESSTDITPEICRRDYWANGGWETFLSIEAPIDLDTTPTSKARTS
PPVLYALCRLRRLPRGGGGRFLGIRPELQGKTSLIREVHVYGNAVGLSERGVSVQHRGYG
RILVREAERIARNEHKSVKLAIIAGVGTREYYSKLGYALDGPYMSRTL
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgaataaatatcaactacaacaaataatgctcgactcggcggtcgttaacgctatcctg
gagatcctcaaggctatcaacgacaaggctggagtcgtagagcaaaaggatgttacacgc
gcaagcgccctagtcgcacgtcaatacagtctgccacaggcaccctctgttgcggacatt
gcgtcctctcttccagcagctcagaagctagagttatctagctatcttgtgcgaaagcct
atcaggtccgcctcgggagttcaagtaattgcagttatgtgtaagccccatcgctgcccg
caccaggtccgtacaggtgcatcgtgcacatactgtggcggcgggccagattccgatttt
gcctactcgactcaatcatacaccggctttgagccgacttcgatgagagctattcgggcg
aggtatgatcccacggagcaggttcgagtccggatggagcagcttaggcagcttggtcac
accacgaacaagatagaagttgtcctcatgggaggaacatttctttcgacgccacgctct
tatcgcgactcgttcatatctggcatctacacagggctgacggggcatatcccagcgggt
cccaagcgaaacatagtcccagaatcaatttcctatgctgctcgctcgtctattaagtgt
gttgcactgaccattgaaacacgtccagactattgcgagccgcggcatctagctgacatg
ctgcggtacggaacgacacgtcttgagattggtgttcagtctgtctacgatgatgtctgt
ggagacatcaaccgtggtcatacagtgcggagcgtaattcgctgctttggacagagtaag
gacgccggattcaaaatgattgcacacatgatgcccaatcttccttttacaagtaccttt
agagacatctttggattccaggagctgtttcagtcaacaaactaccgtcctgacggtctg
aagatctatcccacgctgataatacgtggcacagagctctatgagcgctggcgtttgaac
aagtacctgcgtaacttaccgacgcacaagctcatttatttattaaccatcatctatgtt
ttagcgcccccatgggtaaggatctatcgaataatgcgagatatacctctgccacttatc
tctgctggcgtggactcgtcgaacttacgcgagcttgctctggcgtccctagcacgctct
gaaacacagtcactggaaatcagacaacgggagtcaggaattgtcgaagcggcttccaat
gaaatgactaagaagtctctatacacacaggacggaggaaacgcccgtgagtcttctact
gatattaccccagagatctgtaggagagactactgggcaaacggaggttgggagaccttt
ctcagcattgaggcgccaatagacttggacaccactcctacctcaaaggctcgaacgtct
ccgcctgtcctctacgccctgtgcagattgagaagacttccgcgaggtggcggagggcgt
tttctgggcattcgtccagagctacaggggaagacgtctctgatccgagaggtgcatgta
tatggtaatgcagtgggcttgagtgagcgaggagtcagtgtccaacacagaggctatggg
cgtatactcgtcagggaggcggagcgcatagccagaaatgagcacaaaagcgtcaaactt
gccatcatagcgggcgttggaactagggaatactactctaaattgggctacgcccttgat
ggcccatatatgtcacggacactctag

DBGET integrated database retrieval system