KEGG   Giardia lamblia: GL50803_16829Help
Entry
GL50803_16829     CDS       T01047                                 

Definition
Calcineurin B subunit
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
gla  Giardia lamblia
Brite
Protein phosphatases and associated proteins [BR:gla01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     GL50803_16829
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 190 aa AA seqDB search
MGAAWSNETFDEDFRGITSSLMLREKKRLYRRFMRLSKGQKYIERQTLLDIPEISTNPLK
DRVTLQFIDMNRDRISLKSFIENIEVFSGGTSLEKKATFIFNVYDVDRNAIIDEADMTQI
LTSVLGVADNSDGKGPSLASLKSIARNTIDGMFAIIEKDPEEFERRIDLRTFTLLLDRME
GASLKLTLSM
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgggggccgcgtggagcaacgagacattcgacgaggacttccgggggattacctcgtca
ctgatgcttcgggagaagaagcggctctataggcggttcatgcgactctctaaggggcag
aaatacattgagcgccagacgcttttggacattccggagataagcacaaacccactcaag
gacagggtgaccctacagttcatcgatatgaacagagatcggatcagcctgaaaagcttc
atagaaaacatcgaggtcttctctggggggacgagtctcgaaaagaaggccacgttcatc
tttaatgtgtacgatgtggacaggaacgccatcatcgacgaggcagacatgacccagatc
ctgacgagtgtcctgggtgtggcggataacagcgacggcaaggggccttctcttgcctct
ctaaagtctatcgcacggaacaccatagacggcatgtttgccatcatcgaaaaagacccc
gaggagttcgagcgtcggatagacctgcggacattcactcttctattagaccgtatggag
ggcgcctctcttaagctgactctttcaatgtga

DBGET integrated database retrieval system