KEGG   Giardia lamblia: GL50803_17417Help
Entry
GL50803_17417     CDS       T01047                                 

Definition
Kinase, CMGC DYRK
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
gla  Giardia lamblia
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 695 aa AA seqDB search
MFAPGNSARAQRQVIPGDHFGLVITSGRSVSKGRDQASDAPPPPPARSAAVARARRPYKI
GPTGTSGTNLIFAPASSIVHKAVSVPKQYKHYARDPDDKIEPFSAAASKDTTSKGSSVTT
QPMSSQRSKTTSVRQPKAVTQTLYQQQQEASLLHGNKLGANYAGKNQPIVYIKSKPPSTT
NSRTTTPKRGASTSTRSERTASTSVSPRAVATKLSQRTPSSKGRGVVAATTTPADQNRSQ
LKGSAFPREITAAEVLSSHKSDLTPFEQSEIQRFAKIYYWGQQANKQYNGAINHGYDDSR
GDYIGVINDHIMYRYELVSKLGSGSFGKVYKALDHKEQQFVALKIIKNRKRFQRQGLVEV
KILELLRDNDPNGDQCCVKVLSSFYFRSHLCIAFELLSINLYELLTKKDLKGLSLSLVRK
FSLQLLIAFAYARKLRIIHADVKPENILLREPDKSSIKVIDWGSGAMVSETIYSYIQSRF
YRAPEVILGLPYGQEIDIWSIGCVLCELYTGLPIFPGDDERDQLGKICELLGMPPNDMIF
KSPRKNDFFVNIGTGMGVAGVSEGGNPIFSGNLQQLSSVNEYLQATGRGAGGSEVPGIRL
RTTHKVNSKTLSGVLNAPDDFISFISLFLQWDPQRRCTPEVAMSHPWIQEGIRQINERNA
RPSSTAVRAVDARPDSRRVASASQRPLLPALSPKK
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atgtttgctcctggcaattcagccagagcccagcggcaagtcatccccggtgaccacttc
ggcctggtgataacaagtggtagatcggtcagcaagggcagagatcaggccagtgatgcg
ccgccacctccaccagctcgctccgccgcggtggcccgtgcacgtcgtccatacaaaatt
ggcccaaccggcacatctgggaccaacctcatctttgcccctgcctcgtctatagtccat
aaggctgtatctgtaccaaagcagtacaagcactacgcaagggaccccgacgacaagata
gagcctttctccgctgcggcctccaaggacactacatcaaaaggtagcagcgtgactact
cagccaatgtcgtcacagagatccaagacaacatctgttcgccagcccaaagcagtaact
cagaccttatatcagcaacagcaggaagcctctcttctccatggcaacaagctaggtgct
aactatgcggggaagaatcagcccattgtttacattaaaagcaaacccccctctaccaca
aactcccgcaccacaaccccaaagcgaggggcttctaccagcacacgatcagaaagaaca
gcatccacctctgtttccccaagggctgtcgcgacaaagctcagtcaacgcacaccatcc
agcaagggccggggtgttgtcgccgcaaccacaacgccagctgatcaaaacagatcacag
ctgaagggaagtgcttttccccgcgaaattacagcagcagaagtcctttcctcgcacaaa
tccgatcttacaccgtttgagcaatcagagatccaacggttcgccaagatatactactgg
ggccagcaggcaaataagcaatacaacggagcaatcaaccacggatatgatgatagccgt
ggggactacatcggagtcatcaatgatcacatcatgtacagatatgaactagtctcgaag
ctggggtcagggtcgtttgggaaagtatataaggctctggatcataaggaacagcagttt
gtcgctctaaagattataaagaacaggaagcgcttccagaggcagggcctggtcgaagta
aagattctagagctactacgtgacaacgatcccaatggagaccaatgctgcgtgaaggta
cttagcagcttctactttcgctcacatctctgcatagcgtttgagctgctgtcgataaac
ctatatgaattgctaactaaaaaggatcttaagggcctttctttgtcgttggtccggaag
ttttctctacaacttttaattgcatttgcatacgctcggaagctgaggattatacacgca
gatgtcaaacccgagaacattctcttgcgggaacccgacaaaagcagtatcaaagtcatt
gactggggctcgggggcaatggtgtcagagacaatctactcctatattcagtcccgcttt
tatcgagccccagaggttattcttggtcttccttacggtcaagagatagatatctggagc
attggttgcgttctctgtgagctatacaccgggctgcctatcttcccgggcgatgacgaa
agggatcagctaggaaagatatgtgagctgctggggatgccacccaatgacatgatcttc
aagagtccccgtaagaacgacttctttgttaacataggaacggggatgggtgtggcaggg
gtatcagagggtggaaaccccatcttcagcggcaatctgcaacagctttccagtgtcaac
gaatatctgcaagcaacaggtcgaggagccggcggcagtgaggtgccagggataaggctc
cgcacgacccacaaggttaattctaaaactctgtctggtgtcctcaatgcaccagacgac
ttcatatccttcatcagtctttttcttcagtgggaccctcaaagaaggtgtacacccgag
gttgctatgtcgcatccgtggatacaagagggaatacgacaaattaatgagcgtaatgct
cgtcctagtagtactgcagtacgtgcggtggatgcacgaccagactctaggcgcgttgca
tctgccagccagcggccgctgcttcctgcactcagtccaaaaaagtaa

DBGET integrated database retrieval system