KEGG   Giardia lamblia: GL50803_17563Help
Entry
GL50803_17563     CDS       T01047                                 

Definition
Kinase, CMGC MAPK
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
gla  Giardia lamblia
Brite
Enzymes [BR:gla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     GL50803_17563
Protein kinases [BR:gla01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   GL50803_17563
Exosome [BR:gla04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   GL50803_17563
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 385 aa AA seqDB search
MPLAVFNIKGTRFCVPDYYKVTKALGAGAYGVVAEAVDTRTNTTVAIKKISNLFVHLVDS
KRTLREITILRMLDHENIVKLLDVLVPEDPSNFDDLYVVFDFMQTDMHKIISSKQDLSPD
HMQYFVYQLLRGLKYLHSANCVHRDLKPSNLLLNSDCALEICDLGLARLVDDHAAKTKEL
KDAEKHDTQMTEYVATRWYRAPEIILGWPQYGKPVDIFSVGCIFAELIARKPLFPGRDYI
HQLHLILEVLGTPEKELLDRIASDSAKSYVLALKPSAPQDLSQKFPMLDEAGIDLLTRML
TLDPLKRITVNECLSHPYFEGIHDESDEPVYTGQPLELFFEKYELTKPLLEMCFLNEARK
FHPDELKDEVAKRAKALGIPESVWM
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgccgctggccgtcttcaacatcaagggaacacggttttgcgtcccagactactacaag
gtgacaaaggccttgggggcaggcgcatacggcgttgtcgccgaagcagtagacaccagg
actaacaccaccgtggctatcaagaagatctctaatctctttgttcatcttgtcgactct
aagcgcacactacgcgaaataacgattctccgcatgctagaccacgaaaatatcgtgaag
cttctcgatgtcctggtcccagaggacccctccaactttgacgacttgtacgtcgtgttc
gactttatgcaaaccgacatgcacaagataatctcctccaagcaagacctcagccccgac
catatgcaatacttcgtctaccagctcctgcgcgggctaaagtacctgcactcggcaaac
tgtgttcacagagacctcaaaccctccaaccttctccttaactctgactgtgccctggag
atttgtgacttggggctggctcgacttgtggacgaccacgctgcaaagactaaggagctg
aaggatgccgaaaagcacgacacacaaatgacagagtatgtcgcaacgcgctggtatcgc
gcgccagagatcatactggggtggccgcagtatgggaagcctgttgacattttctccgtg
ggctgtatctttgcagagctcatcgccagaaagcccctgtttccaggtagagattatatc
caccaactacacctgatcctcgaggttttgggcaccccggagaaggagcttctagacaga
attgcgtcggactcggcgaagagctacgtcctcgccctcaagccctcggcgccgcaggac
ctttcacagaagtttcccatgctggatgaggcgggcattgacctccttacccgcatgctc
acactggatcccttgaagcgcatcaccgttaacgagtgcctcagccatccctactttgaa
ggaatccacgatgagtctgacgagcctgtctacaccggtcagcctcttgaactcttcttc
gagaagtacgagctcacaaagccgcttcttgagatgtgcttccttaacgaagcacgcaag
ttccatccagacgagcttaaagatgaggttgcaaagcgtgccaaagccctggggatcccg
gagtctgtgtggatgtaa

DBGET integrated database retrieval system