KEGG   Giardia lamblia: GL50803_22165Help
Entry
GL50803_22165     CDS       T01047                                 

Definition
Kinase, STE STE20
Orthology
K04368  
mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
gla  Giardia lamblia
Brite
Enzymes [BR:gla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     GL50803_22165
Protein kinases [BR:gla01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   GL50803_22165
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 357 aa AA seqDB search
MKRRPMALTLDASTASADGGVEDVQKGGSGTQYIKITDSGSLNTLHESLQISAHGITKTS
SPEHILNVQESDLEVVKPLGAGAFGTVNLVKVKTTGQLCAMKEIRISDEEQTQKNIYREI
KASISLSCNPYMVKTYNIYSHPGSILHILLEFCKYGSSQDMLKKLKTGKLTENALAVFII
DTLRGLAYLHDNCKIIHRDIKSANILIDEHGYCKLADFGVASSVLPNDDEAAMKTFVGSL
SYMSPERIQNQPYSYVSDVWSMGLTYVELLTGSYPYDNVNSFWDAMNVIVNGAPPLLKED
AGYSPGLCDLVNAMLEKDPSKRMTAAQLLKLPFCKKYLAKEEDLRKLFVKWVQDNLK
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgacgcccgatggctcttacgctcgatgcctcgaccgcctccgcagatggtggc
gtggaggatgtccagaaaggaggcagcggcacgcagtacatcaagataaccgactcgggg
tccctcaatactttacacgagtctcttcaaatatcggcgcacggcatcacaaagaccagc
agccccgagcatatcctcaacgtccaggagagcgacctcgaggtcgtcaagcccctcgga
gccggcgccttcgggacggtgaacctagtaaaagtcaagaccaccgggcagctctgtgca
atgaaagagatccgcattagcgacgaggagcagactcagaagaacatttacagggagatc
aaggccagcatcagcctttcgtgcaacccgtacatggtcaagacgtacaacatatattcc
catccagggtccatccttcacatattgctagagttttgtaagtacgggtcttctcaggat
atgcttaagaagctcaagacggggaagctcactgaaaacgcccttgctgttttcattatt
gatacactccgcggcctggcgtatcttcacgacaattgcaagatcatccacagagatata
aagtctgccaacatcctcatcgacgagcacggctactgtaagctcgccgacttcggggtc
gcttcatccgtgctgccgaacgacgacgaggctgccatgaagacgtttgttggttcgttg
tcctacatgtccccagagcgcatccagaaccagccttactcgtacgtttcagatgtctgg
agcatggggctgacatatgtcgagcttctgacgggttcctatccatacgataacgtgaac
tctttctgggatgctatgaacgtcatcgtcaacggagccccccctctgttgaaggaggat
gctgggtacagcccggggctctgcgaccttgtcaacgccatgctcgagaaagacccctca
aagcgcatgactgccgcacagctcctcaagttgcccttttgcaagaagtaccttgccaag
gaggaggacctgaggaagctcttcgttaagtgggtccaggataacctcaagtga

DBGET integrated database retrieval system