KEGG   Giardia lamblia: GL50803_22850Help
Entry
GL50803_22850     CDS       T01047                                 

Definition
Kinase, CMGC MAPK
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
gla  Giardia lamblia
Brite
Enzymes [BR:gla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     GL50803_22850
Protein kinases [BR:gla01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   GL50803_22850
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 360 aa AA seqDB search
MSDDESIDRHVLRKYEIIHRVGKGAYGVVWKAVNRKTNETVALKKIFQAFQNDTDAQRTF
REIMFLQELDHDNIIRLFNVLKAENDKDIYLVFEFLDSDLHQVIKSNILEDIHKRYIIYQ
CVKALKYLHSAEILHRDLKPSNLLLNSECHMKMADFGLARSIAALSEPSSATNPILTDYV
ATRWYRSPEILLGCTRYTKGVDMWAIGCILGEMLGGSPMFPGSSTMNQLDKIMEVTGRPT
PEDIEATESPFASMMLDSLQPKTGKALSEIYPNAPADALDLLKKLLQFNPNKRLTAEQAL
EHPYLSKFHDPATEPSAPGPIKISIDDDDKRSVSEYRDLLYSEILRKKKEIRSKSLKEDE
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacgacgaatcgatagaccgccacgtcctccgcaaatatgagataatccaccgc
gtcgggaagggggcctatggggttgtctggaaggcggtgaacaggaaaactaacgagacc
gtagccctaaagaagatatttcaagccttccaaaacgacaccgatgcccagcgcaccttc
cgtgagataatgttcctccaggagctagatcacgataacataattcgtctcttcaacgtg
ctgaaggccgagaacgacaaagacatctacctggtatttgagtttctggacagtgatctg
caccaggtgatcaagtccaatatcctcgaggacattcacaagcgctacataatctatcag
tgtgttaaggcgctcaagtaccttcactctgccgagatactccatcgtgatcttaagcct
tctaacctcctactcaactctgagtgccacatgaagatggcggatttcggcttagcaagg
tcgattgctgcgctttctgagccaagctctgcgaccaacccaattcttactgactatgtt
gcaacgcgctggtacaggtcccccgagattcttctgggttgtacaaggtatacgaagggc
gtcgacatgtgggctatcggctgcatccttggggagatgcttggagggtctcccatgttt
ccaggatcgtctaccatgaaccagcttgacaagataatggaggtcactggaaggccgaca
ccggaagacattgaggcgaccgagtctccgtttgcgtccatgatgctggacagccttcaa
ccaaagactggaaaggctctctcggagatctaccccaatgcccctgctgatgctttggac
cttctcaagaagctactccagttcaatcccaacaagcgactgaccgcagagcaagccctg
gagcacccttacctgtcaaagttccatgatcctgctacggagcccagtgcccctggccct
attaagataagtatagacgacgatgataagaggagcgttagcgagtatcgtgatttactt
tactctgagattctcaggaaaaagaaggagatccgctccaagagtctaaaggaagacgag
tga

DBGET integrated database retrieval system