KEGG   Giardia lamblia: GL50803_2851Help
Entry
GL50803_2851      CDS       T01047                                 

Definition
Histone acetyltransferase MYST2
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
gla  Giardia lamblia
Brite
Enzymes [BR:gla01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     GL50803_2851
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 425 aa AA seqDB search
MTAKDLTEPYKKGLIFMACCREDIGTPLENTPRPVRIYDSREDPTARGSYEYYVYFGGYN
ARLADWYPSSALRSITDEERQLYAKEIWFFSQADKEFLPRNIDKVVISQYVMCPWYFSPL
PEEFFASRTVYICEYCFTMLTTERIYKRHVARCTCRSPPGDLIYRDDEVCFFEINGSEHT
NYCRNICLVARLFLQHKTLVADVDVFLFYVMFAKTNNKKANNQQLSAAQKASDEQEQRAH
CEPEIKRIPDWQQTGPGDQDDDSYHFVGFFSKEKQQENSLSCIVALPCFQKKGYGNMMIN
FSYMLSSRECRLGGPEMPLSDLGLMSYLSYWKRRICEVLVRNTTSEISLFEISKQTMISY
RNLIMAMNKYGLLKETPSNTAIYFGNELADELRTCLEKEEKRGVHRLEDKYLHWVPYVNM
CYEYK
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgacagcaaaagatcttactgagccgtataaaaaggggctaatcttcatggcatgctgt
cgggaagacatagggactccattggagaacactccgcggcctgttagaatctatgatagc
cgcgaagaccccacagctcgcgggagctacgagtattatgtttattttggagggtacaac
gcccgcttggcggattggtacccgtcatcggccttacgaagcattacagatgaagaaagg
caattatacgcaaaagaaatatggttttttagccaggcagacaaggaatttctgcccagg
aatatagataaagtggtgatctctcagtacgtgatgtgtccgtggtacttctcgccactc
cccgaggagttttttgcctccagaactgtctacatctgcgagtattgcttcaccatgttg
accactgagcggatctacaagcgccatgtggcccggtgcacctgtagatcaccacctggt
gacctcatatatagagatgacgaagtctgcttctttgaaatcaacggcagtgagcatact
aactattgccgtaatatatgcctagttgcgcggcttttcctgcagcataaaacattggtg
gcagacgtagatgtcttcctcttttatgttatgtttgcaaaaaccaacaacaaaaaggct
aataaccaacaactatcggcagcccagaaggcttccgatgaacaagaacaaagagctcac
tgcgagcctgaaataaagcggatacccgattggcaacagacgggaccgggtgatcaggac
gatgactcataccattttgtaggatttttctccaaagagaaacagcaagaaaatagtctc
agctgcattgttgcacttccatgctttcagaagaaaggatatggaaatatgatgataaac
ttttcgtacatgctcagtagccgtgaatgtagactcggaggacctgagatgcccctgtcg
gaccttggcctcatgtcctacttaagttattggaagcgccgaatttgcgaagtgctggtt
cgcaacaccacttcagaaatcagccttttcgagattagtaagcaaacaatgatcagctac
cgcaatctaatcatggcaatgaataagtacgggcttctgaaagaaacaccgtcaaatacc
gctatttactttggaaacgaactagcagatgagttgcgcacgtgtttagagaaggaggaa
aaacgcggagtacaccgtcttgaagacaagtacctccattgggtcccatatgtcaacatg
tgttacgagtacaaatag

DBGET integrated database retrieval system