KEGG   Giardia lamblia: GL50803_29307Help
Entry
GL50803_29307     CDS       T01047                                 

Definition
(RefSeq) UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
  KO
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
gla  Giardia lamblia
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:gla00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    GL50803_29307
   00052 Galactose metabolism
    GL50803_29307
   00500 Starch and sucrose metabolism
    GL50803_29307
   00520 Amino sugar and nucleotide sugar metabolism
    GL50803_29307
Enzymes [BR:gla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     GL50803_29307
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 450 aa AA seqDB search
MSYQDLLSARLKELAAGGYMSATEVAGARDLFIRHHQGAPAPVEWCRVQALSDSGYRAYD
TLPELDGPSLTKAMQKVAVLKLNGGLGTSMGCTGPKTLIPVKNQMSFLEIIVRQVSSINT
KYGISMPLLLMNSFNTEKDTKAALAQIHLDKPVDITCFNQAHFPRLDAETLLPCTHITPD
NQAYWYPPGHGDVLRSLISESLVDKLIARGVEWIFISSGDNLGAVVDPRIVGYLATLKGV
DFVSEQTAKTIRDVKGGVLINYDGTTRLLETAQVPQEHMGEFCDITKFKSFNVNSIWVRL
EALKRLADAGTPIDLDIIVNPKVVEGKRVIQLEQAVGAGITFFKSEGLLVSRDRFIPVKK
TCDLLTVQSDVYDLDSEYVLRACCSIPTVELCAPLEKMDAYCAAFQCLPSLRGADTVKIL
SQCTIGPNVEFRGTCTIDNTSHLENCTLGQ
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgtcctatcaggatctgctcagcgctcgcctgaaggagctcgccgctgggggctatatg
tcggccactgaagtagctggagcaagagaccttttcattaggcatcaccagggggcccct
gcgcctgtggaatggtgtagggtgcaagctctatcggactctggctaccgtgcatacgat
accctccccgagttggatgggccgtcgctgacaaaggcaatgcaaaaggtcgctgtcctc
aagcttaacggaggcctggggacatcgatgggatgcacgggccccaagacccttattccc
gtaaagaaccagatgtccttcttggagatcattgtaaggcaggtctcttccattaataca
aaatatggaattagcatgcctctgctcttgatgaactctttcaacacagaaaaggataca
aaggctgctctcgctcagattcacctagacaagcccgtggacatcacatgcttcaaccag
gcgcattttccacgcctagatgccgagacccttctaccatgcacccacatcacccccgac
aatcaggcgtactggtatccgccggggcacggagacgttctcaggtccttgatcagtgag
agccttgtcgataagcttattgctagaggagtagagtggatctttatcagcagtggagac
aaccttggtgctgtggtggatccgcgaattgtagggtacctggcaactcttaagggagtc
gactttgtttccgaacaaacagccaagacgatccgtgacgttaagggtggtgttctgatc
aactatgatgggacgacacgccttctagaaactgcgcaggtccctcaggaacacatgggc
gagttttgtgacattacgaagtttaagtcatttaatgttaacagcatctgggtccgctta
gaagcactaaagaggcttgcggacgctggaactccaatcgacctagacatcattgtcaat
cctaaagtagttgagggaaagcgtgtcatccagcttgagcaagctgttggtgcaggaatc
acatttttcaagtctgaagggttgcttgtcagccgtgatcgcttcatccccgtgaaaaag
acctgcgatctgctgactgttcaatccgacgtgtacgaccttgattccgagtatgttctt
cgagcttgttgttcgattccgactgttgagctgtgcgccccgctcgaaaagatggatgca
tactgcgccgcttttcagtgtctcccttcacttcgcggcgctgatacagtgaagattctt
agccaatgcactatcggaccgaatgtagagtttcgagggacgtgcactattgataacaca
agtcatctagagaattgcactctgggacagtga

DBGET integrated database retrieval system