KEGG   Giardia lamblia: GL50803_29307Help
Entry
GL50803_29307     CDS       T01047                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
gla  Giardia lamblia
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gla00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    GL50803_29307
   00052 Galactose metabolism
    GL50803_29307
   00500 Starch and sucrose metabolism
    GL50803_29307
   00520 Amino sugar and nucleotide sugar metabolism
    GL50803_29307
Enzymes [BR:gla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     GL50803_29307
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 450 aa AA seqDB search
MSYQDLLSARLKELAAGGYMSATEVAGARDLFIRHHQGAPAPVEWCRVQALSDSGYRAYD
TLPELDGPSLTKAMQKVAVLKLNGGLGTSMGCTGPKTLIPVKNQMSFLEIIVRQVSSINT
KYGISMPLLLMNSFNTEKDTKAALAQIHLDKPVDITCFNQAHFPRLDAETLLPCTHITPD
NQAYWYPPGHGDVLRSLISESLVDKLIARGVEWIFISSGDNLGAVVDPRIVGYLATLKGV
DFVSEQTAKTIRDVKGGVLINYDGTTRLLETAQVPQEHMGEFCDITKFKSFNVNSIWVRL
EALKRLADAGTPIDLDIIVNPKVVEGKRVIQLEQAVGAGITFFKSEGLLVSRDRFIPVKK
TCDLLTVQSDVYDLDSEYVLRACCSIPTVELCAPLEKMDAYCAAFQCLPSLRGADTVKIL
SQCTIGPNVEFRGTCTIDNTSHLENCTLGQ
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgtcctatcaggatctgctcagcgctcgcctgaaggagctcgccgctgggggctatatg
tcggccactgaagtagctggagcaagagaccttttcattaggcatcaccagggggcccct
gcgcctgtggaatggtgtagggtgcaagctctatcggactctggctaccgtgcatacgat
accctccccgagttggatgggccgtcgctgacaaaggcaatgcaaaaggtcgctgtcctc
aagcttaacggaggcctggggacatcgatgggatgcacgggccccaagacccttattccc
gtaaagaaccagatgtccttcttggagatcattgtaaggcaggtctcttccattaataca
aaatatggaattagcatgcctctgctcttgatgaactctttcaacacagaaaaggataca
aaggctgctctcgctcagattcacctagacaagcccgtggacatcacatgcttcaaccag
gcgcattttccacgcctagatgccgagacccttctaccatgcacccacatcacccccgac
aatcaggcgtactggtatccgccggggcacggagacgttctcaggtccttgatcagtgag
agccttgtcgataagcttattgctagaggagtagagtggatctttatcagcagtggagac
aaccttggtgctgtggtggatccgcgaattgtagggtacctggcaactcttaagggagtc
gactttgtttccgaacaaacagccaagacgatccgtgacgttaagggtggtgttctgatc
aactatgatgggacgacacgccttctagaaactgcgcaggtccctcaggaacacatgggc
gagttttgtgacattacgaagtttaagtcatttaatgttaacagcatctgggtccgctta
gaagcactaaagaggcttgcggacgctggaactccaatcgacctagacatcattgtcaat
cctaaagtagttgagggaaagcgtgtcatccagcttgagcaagctgttggtgcaggaatc
acatttttcaagtctgaagggttgcttgtcagccgtgatcgcttcatccccgtgaaaaag
acctgcgatctgctgactgttcaatccgacgtgtacgaccttgattccgagtatgttctt
cgagcttgttgttcgattccgactgttgagctgtgcgccccgctcgaaaagatggatgca
tactgcgccgcttttcagtgtctcccttcacttcgcggcgctgatacagtgaagattctt
agccaatgcactatcggaccgaatgtagagtttcgagggacgtgcactattgataacaca
agtcatctagagaattgcactctgggacagtga

DBGET integrated database retrieval system