KEGG   Giardia lamblia: GL50803_29307Help
Entry
GL50803_29307     CDS       T01047                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
gla  Giardia lamblia
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:gla00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:gla00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:gla00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:gla00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 450 aa AA seqDB search
MSYQDLLSARLKELAAGGYMSATEVAGARDLFIRHHQGAPAPVEWCRVQALSDSGYRAYD
TLPELDGPSLTKAMQKVAVLKLNGGLGTSMGCTGPKTLIPVKNQMSFLEIIVRQVSSINT
KYGISMPLLLMNSFNTEKDTKAALAQIHLDKPVDITCFNQAHFPRLDAETLLPCTHITPD
NQAYWYPPGHGDVLRSLISESLVDKLIARGVEWIFISSGDNLGAVVDPRIVGYLATLKGV
DFVSEQTAKTIRDVKGGVLINYDGTTRLLETAQVPQEHMGEFCDITKFKSFNVNSIWVRL
EALKRLADAGTPIDLDIIVNPKVVEGKRVIQLEQAVGAGITFFKSEGLLVSRDRFIPVKK
TCDLLTVQSDVYDLDSEYVLRACCSIPTVELCAPLEKMDAYCAAFQCLPSLRGADTVKIL
SQCTIGPNVEFRGTCTIDNTSHLENCTLGQ
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgtcctatcaggatctgctcagcgctcgcctgaaggagctcgccgctgggggctatatg
tcggccactgaagtagctggagcaagagaccttttcattaggcatcaccagggggcccct
gcgcctgtggaatggtgtagggtgcaagctctatcggactctggctaccgtgcatacgat
accctccccgagttggatgggccgtcgctgacaaaggcaatgcaaaaggtcgctgtcctc
aagcttaacggaggcctggggacatcgatgggatgcacgggccccaagacccttattccc
gtaaagaaccagatgtccttcttggagatcattgtaaggcaggtctcttccattaataca
aaatatggaattagcatgcctctgctcttgatgaactctttcaacacagaaaaggataca
aaggctgctctcgctcagattcacctagacaagcccgtggacatcacatgcttcaaccag
gcgcattttccacgcctagatgccgagacccttctaccatgcacccacatcacccccgac
aatcaggcgtactggtatccgccggggcacggagacgttctcaggtccttgatcagtgag
agccttgtcgataagcttattgctagaggagtagagtggatctttatcagcagtggagac
aaccttggtgctgtggtggatccgcgaattgtagggtacctggcaactcttaagggagtc
gactttgtttccgaacaaacagccaagacgatccgtgacgttaagggtggtgttctgatc
aactatgatgggacgacacgccttctagaaactgcgcaggtccctcaggaacacatgggc
gagttttgtgacattacgaagtttaagtcatttaatgttaacagcatctgggtccgctta
gaagcactaaagaggcttgcggacgctggaactccaatcgacctagacatcattgtcaat
cctaaagtagttgagggaaagcgtgtcatccagcttgagcaagctgttggtgcaggaatc
acatttttcaagtctgaagggttgcttgtcagccgtgatcgcttcatccccgtgaaaaag
acctgcgatctgctgactgttcaatccgacgtgtacgaccttgattccgagtatgttctt
cgagcttgttgttcgattccgactgttgagctgtgcgccccgctcgaaaagatggatgca
tactgcgccgcttttcagtgtctcccttcacttcgcggcgctgatacagtgaagattctt
agccaatgcactatcggaccgaatgtagagtttcgagggacgtgcactattgataacaca
agtcatctagagaattgcactctgggacagtga

DBGET integrated database retrieval system