KEGG   Giardia lamblia: GL50803_3281Help
Entry
GL50803_3281      CDS       T01047                                 

Definition
Histone deacetylase
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
gla  Giardia lamblia
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 467 aa AA seqDB search
MPPSKPSFFYNPLFPTFYFGLHHPMKPFRIALVNELILAYGLDEHLNYYTPRDATFQDMA
LYHTPDYIRFLKNITPETLSKFQDLAKRYNITEDCPVFSGLYDYCSMTVGASVNACAHLN
HGMCDVALNWMGGFHHAKASEASGFCYANDLVLGILELLKVHERVLYVDIDIHAGDGVEE
AFYTTNRVLTLSFHKYDTDFFPGTGNLFDNGADQGKGYAINFPLKDAIDDDTFIYIFGSV
VKDVMCCYDPQAVVLQCGADSLAGDRLGVFNVTLKGHGECVKILYQYTQAKGIPLLLTGG
GGYTARSAAKCWTYETSLVCNQVLSEQIPANQFYEYYGPDYSLLVPRINLPNQNTRQDIE
QKLTHIRQKLREIQPANACGGSSTLTSVMPASVETSKEMLQGKDRDYYGGRPLAEDEDGL
GQHEKEGVSEGTRERARQNRDEPTVVVMGQNGFVDGALRSEAGLDEN
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgccgccttcaaaaccctccttcttctacaacccactcttccccaccttctactttggg
ctgcatcatccgatgaagccattcaggattgccttggtgaatgagcttattttagcatac
ggcttggatgagcatttgaactactatacacctagagacgccacttttcaggacatggct
ctttaccacacccctgattatatacgctttctgaaaaatatcacgcctgagactctttct
aagttccaggaccttgccaagagatataacattaccgaagactgccccgtgttctctggg
ctctacgactactgtagcatgacagtgggtgcttctgttaatgcatgtgctcacttgaat
catgggatgtgcgatgtagccctcaactggatgggcgggttccaccatgcaaaggcttct
gaagcctctgggttttgttatgccaatgatcttgtcttagggatacttgagctcttgaag
gtacacgagcgtgtgctgtatgtagatattgacatccatgccggagatggagtcgaggag
gccttctataccacaaatcgggttttgactctgtcattccacaagtacgacacagacttc
tttccgggcaccggcaatctgtttgataatggagctgaccaagggaaagggtacgccatt
aattttccgctgaaagacgccatcgatgatgacacattcatctacatctttggaagcgtg
gtaaaggatgtgatgtgttgctatgatccacaagcagttgtcttgcagtgtggagcagac
tcgctggcaggcgatcgactaggggtcttcaatgtcaccttgaaaggtcacggggagtgt
gttaagattctgtatcagtatacgcaagcgaagggcataccgcttctcttaacaggtggg
ggtgggtatacagcgcgttctgccgccaagtgttggacatatgagacatcactcgtctgt
aaccaggtcctgtccgaacagataccagcaaatcagttctacgagtactatggccccgat
tattcgctgcttgttccacgcatcaatcttcccaatcagaacacaagacaggacattgag
cagaagctcacacacattcgacaaaagctcagagaaatacaacccgcaaacgcatgtggt
ggtagcagcacgttgacaagcgttatgcctgcttctgtggagactagtaaggagatgcta
caagggaaagatagagactactatggagggcggccactggccgaagatgaagatgggttg
ggtcagcatgagaaagaaggtgttagcgagggtacacgagaacgggctcggcagaatcgg
gatgagccaaccgtagttgttatgggtcaaaatggttttgttgacggcgccttgcgaagt
gaagcggggttagatgagaactag

DBGET integrated database retrieval system