KEGG   Giardia lamblia: GL50803_35180Help
Entry
GL50803_35180     CDS       T01047                                 

Definition
GTOR
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
gla  Giardia lamblia
Brite
Protein kinases [BR:gla01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   GL50803_35180
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 3227 aa AA seqDB search
MSTDAITSSRFYPYLADLKSIDPNIYTRAAMAIRMQVEKDSRQMLADPRTLFISDLMSFI
RNLATSSSYEDRLASLWVMRELIQSRPTISMIPLTYFEEIALELVNDPSEVIILTNCVFI
GRLINAEGHGIDFVPKLFVISIDKIKSGDSTKVYTGMLLFNDLTEVETSFAIDISSEEFL
EPIWHVITETRNSNIKEVGFKAINKFISYQKKATKHDVLVRLITMIRAALDGKNISEQLI
ALHLLLNMLNLSVKDKSIADYFQENYSSFFSLVANIFRSKTSEGRMLVASIISLFAKLDP
ERFCTTERLQMILTFYKKMIPTQQELFIPLGEFVIVIGEKHVKPIFNDLINLITSSFKSQ
NFTKAGSILPPEPLKCIQYITKGAPNLVQKHVTSILECIFSVGLCESLTSALQDLSANLH
NRLLDIQGLLLYLVANELGGINLFLSNAYGVIDGSEDYYLVLTENQSQAVADGHDSGVLD
SQTSIIPGTRPSTTQATTHVEDTRTNEDAIELAHDLSITGLKEESEQCDFKNSLSVYQTV
TTSAGITALYKLSDRIATALGTSKLRPRRHSTSEAILLAFQALYDFDFSLFDLTIFAADY
LTRYLRNDSSTLRIKAAQTILKLMSEDHFEKIRRGKHSQYKSMTIKAEDCHSWAGSTLGE
APTPSGGATIIPPAVVSNQSFATTISPKTRHIRTHSSSHLDDMSSTSFCINQDCILSQDI
LKSSDLGTDGFFNSGPYRHMLISDTLRQIIIIGTTDIDPEVRMSIIQALTTTNRYDIYLV
HESSLRTLFIALYDDNIEIRILAVKLIGRLCSLNPALVTPEIRHLILVLLTELRLTTENN
KRATSNELIVKIFKFCGSIVLPYVPMVYSAVMGLISKDCDDEYLLITSLTTLAELFTIGS
TSMVHCLAEVIPLLITCIKEETSKTLRLTTTRCFVRIVEATSFVVFPWFIYHDLFTIVFG
ILKNDTSQEIRLEAAKLITTIGAIDPIFYQNGKPDLSALVPPTNLTCKCQSTDVFSLDYI
MDESNIWVCHKGEGGAAQEASIKSHGKAVVSPITGHVVENVYIMKLDSGSEVSANVSDFE
LTLNVIMSTLYSILSESTLDMYHYDAVVVFRTIIQTECTAISLPMVPKIISLILENIQNC
KVFMQETMLRELILIISSIGHHAHSYVSDIFDIIEVLWANQQLIELILALLEEVSIVLDL
SLGNYGSQFFLKFVGLFTVLKSSQEISDSAKKLLIRACRSVVALSSLFSNHIHLIVDLLC
SGIRKQKLGKELRFALLDTLSRLTICTNLSRFGASIIHPILEVIMEADPCTSVEHNKNAN
PEKGLNPMNIVSYKAFEVLHFICAQFGVSVTLYIPVITECLLKVGFTSGLLDSIFSLLLR
REEVDPVTFYRLICEWKKKQAKKFSEYTSLASLLAMYETPVTQDTLLYMESISNKVPGDD
KDAMILVVKDINFDDIGSVINYLHTSSTWFGDDMRPLPAGAIGVHSLSIQENDMLNKHVT
IPQQIWRADTCKKNEEWRHWLSNLSLTLLQCSPLKCLRACHKLATSYPRVARDLFNYSFL
ACLSETYPSNNEHRNYIVESIRSVFLSQNCPLDVLQILLDLAEFWENRSREFSTTFSHNF
LGEVAERCHAYTRSLRYKETEYAQHPIEAVGRLIAINYSLGYEETAIGTLRVECKRLNFI
STNLIYDILLRCLYTGLDDVFTMMQREGGLEPGAAVNCSAESTLERIINKVVSKIVTKAL
TEAKKISNLNQSIPQQLVSYGSIGGIFVEGRPVMSGPEGSVLQVDYNEIGIYLSALARRM
LKSKLTYQYPTFLMYEENLFQSVLKTLRYKAQGHMQDLYGPSPKWFENVCLWDKALSGYN
RQIDQLKLSLKSNTSEARTLLPMLVNLTKDKIRCLFALADYSAVQEEADQLLNYLSSESK
EEAGLTTVKHTLIKGFQADIATYAAWSLLEQDQEDVEIWLRVLPEDNIDGTIIRATSYIK
ANKMLEAHKLLCKLRLRIDPDLIGLSAESYTRAYNLCILLQTITELQNIISYKLALNGLK
LDAPSTLIKEGGNPYENIFETTLISFNPPPGFADTEKERLRLMWSRKISMIRWDCESWEA
LLRVRRLIIFPIEDQEVWIRFSVLCLQSGRVQLARKTLETFINSSSVHHIKVSKSRGLYT
LLGLTSFGTPRRYLKHGSGDVSTGGSVTPIGSALGAEMGVVQDLSAVGSSLAKYLLKDGV
VKDAFTAQQHVALPTSDVLSIASHSVAKPTLQMIANASTHQGQSIEKETPLSIVGQQCDD
AKRNAQRDLFNALIPPLNHVYPHVLYAYCKHLWVSSNENVLEKLVAFTHLIRLCNDVSIQ
KTEPKLVCRMLIRLGAWYSDLLTPLDHKSCSMIGTISPSEGYVNIPVQDTVTSCSAIWNS
IVNNCDADASVCSTTYEATEHSAERLELSSASTLDKAVAKLVDNILLAYDELSNVSLEEC
NQYNTVGMSRIGLIALEWFQVAADRDETSNHIWKCISHTTYAIVNSFAAYIDKLNDRPGV
DGGLQIVTRRSSVDATSDAVGSTSEALSQSVQDSDRPLVCPEHLGFVQNRQVLLEKAKLE
YLVESIIAHFKCIETGRSIEALPTTLRLMTLWFRYGSYDEVETEIINGLAAVPINIWLDV
IPQLIARLHSPQHKIRLLVHQLLVLIGTEHPQALIYPLVVASKSTILNRRVESLSIVDQI
RRTNEAMILESLNINKELQRVAILWPEIAYDLITQASTAFCEEPRDLVKFFNYACQLQLL
ASRTPETQSESVFIQMFSSQLQAAWDSCRQFPVTNDLVCLNIVMKHYKEIYDRIHSELPF
LNTIDLLQTSPLLYNISNTNLCVPGSYHPARAITTIVKFYQKVFVIRSKQRPRKVGLVAS
DGEYYAFLLKGHEDLRQDERVMQLFTLINNLLMNDSYCSRRGLMVMKYPITPLSQNSGLL
YWVPGCDTIISLIKEFRQLKRIHLETEMQQIKYRAPAFMNMALHYKVDAFKYMLTTSDAI
DLCRSLWNKASSAEDWLLKRMNYTRSIAVSSIVGYILGLGDRHPANLMIERTTGMVLHID
YGDCFEVAMHREQLPEKVPFRLTSIMMKAFESCGTEGSFRMTGEATMSILRSNKDSLVSV
LETFIYDPLMSMKVLSGENTMGGKENIDGNTEFYGTRRPVQESYLEGNERNPKAVKIVQR
IYDKLTGYDIKYIDRSLSVSEQIQSLIHSATNAENLCQLYIGWCPYW
NT seq 9684 nt NT seq  +upstreamnt  +downstreamnt
atgagcacagacgcaattacttctagccgcttctatccctatctagctgacctgaaatct
atcgatccaaacatctacacacgcgcagcaatggcgattcgcatgcaagtcgaaaaggac
agtagacaaatgcttgccgatcctcgtactctttttatatctgatcttatgagttttata
aggaatcttgccacttcctcaagctacgaagacagactcgcaagtctctgggtcatgagg
gagctcatccaatcccgtcctaccattagcatgattcctttgacgtactttgaagaaatc
gcccttgaacttgtcaacgacccttctgaagttattattcttactaattgcgttttcatt
ggtcgattgatcaacgctgaaggccacggaatagactttgttccaaagttgtttgtaata
agcattgataaaattaagagcggagactcaacaaaggtctacactggcatgctgctattc
aatgacctaactgaggtggagaccagttttgccatagatatctccagcgaagagtttctt
gaaccaatctggcatgtgattacggaaacgcgaaacagcaatatcaaggaagtgggcttc
aaggctattaataaattcatatcctatcaaaagaaagctacaaagcatgacgttctggta
cgtctcataacaatgattagagctgcgctagatggcaagaacatttctgagcagctcatt
gccctgcatctgctcctgaacatgcttaatttgtcagtcaaagacaagtcgatagcagac
tatttccaggaaaactacagcagttttttttctctcgtcgccaatatcttccgttctaag
acatccgaggggcgtatgcttgttgcatccattatctcgctttttgctaaattagaccca
gagagattttgcacaactgaacggctacagatgatactgacattttacaagaaaatgata
cccacacaacaggagctgtttattcctctaggagagttcgtcatagtcataggggaaaag
cacgttaaaccaattttcaatgacttaatcaatctcatcacctcatcttttaagtcacag
aatttcacaaaggcagggagtatactaccaccggagcctctcaagtgtatccaatacatt
acaaaaggggcgccgaacctcgtccagaaacatgtcacttcgattttggaatgcatcttc
tctgtgggactctgtgaatctctcacctctgctcttcaagacctttctgcaaatttacat
aaccggctactggatatccaaggcctacttctttacttggtcgccaatgagctgggtgga
atcaacttgtttctttccaatgcttatggagtaattgatgggtcagaagattactatctt
gtgcttacggagaatcaatctcaagcagttgctgatggacatgactcaggcgtccttgac
tcccagacttccattatccccgggacacgaccctcaactacccaagccaccactcacgtg
gaagatacgcgcaccaatgaagatgcgattgagctggctcacgacttatctattactggt
ctcaaagaggaatcggagcaatgtgactttaaaaactctctttctgtctatcaaactgtt
actacatcagccggtataacggcgttatataagctttcagatcgcattgcaacagcatta
ggaaccagcaagcttcgtccccgtcgccactccacaagtgaagccatccttttagcattc
caagcgctatacgattttgactttagtttatttgatctgacaatctttgcagctgattac
ctgacgcgctatctccggaatgacagtagcacacttcgcatcaaagcagctcaaactatt
ctaaagctaatgtctgaggaccactttgaaaagatacggcgtggaaagcactcgcagtac
aaaagtatgactataaaagcggaggattgtcactcttgggctgggtccactcttggagag
gctccgacgccatccggtggagccacaattatcccacctgctgttgtttccaaccaatca
ttcgctaccactattagccccaagactagacatatcagaacacactctagttctcacctt
gatgacatgagctccacaagcttctgtattaaccaggactgcattttgtcccaagacatc
cttaagtcgagcgatctaggcactgatggcttttttaattcgggtccataccgacacatg
cttatatctgacacgctgcggcaaatcattataataggaaccacagacatcgatccggag
gtccgcatgtctataattcaggcgttaaccactacaaataggtatgatatatatcttgtg
cacgagagcagtctcaggaccctttttattgctttgtatgatgataatattgagatacgc
atccttgccgtgaagttgataggccgtctctgttcgttgaatcctgcgcttgtgactccc
gaaatcaggcatcttattctcgttctattgacagaactccgtctgaccacagaaaataat
aagagggctacatccaatgagctgatcgtcaagatatttaagttttgcgggtccattgtt
ctcccttacgtgcccatggtatattcagctgtcatggggctcatttcaaaagactgtgac
gacgagtacttgctgattacatctcttacaactcttgctgagcttttcactatcggctcc
actagtatggtacattgtctagcagaggtcattcctcttctgattacttgcattaaagaa
gagacgtcaaagactctgagactgaccaccacccgatgctttgttcggattgttgaagca
acatcattcgtcgtcttcccatggtttatttaccatgatctctttaccatagtgtttggt
atccttaaaaatgatacatctcaggaaatacgtcttgaagcagccaagcttataacgacc
atcggcgctatcgatcccatattctatcagaatgggaagccggatctatctgcgcttgtt
cctcccaccaatctgacctgtaagtgccagtccaccgacgtcttttccttagactatatc
atggacgagtctaacatctgggtatgccacaagggtgaaggaggcgcagcacaagaagcg
tctatcaaatcgcatggaaaggcggttgtcagtccaataacgggccacgtcgtggagaac
gtctatattatgaaactggatagcggatccgaggtttctgctaatgtctctgattttgag
ttgactctaaatgtgattatgtctacactttactctatcctgtctgagagcaccttagac
atgtaccactatgacgccgttgtggtctttcgaacaattatccagacagaatgcacagcg
ataagcctcccaatggtgcctaagataatatctttaattcttgaaaacatacaaaattgt
aaggtattcatgcaggaaacaatgcttcgcgagctcattcttataatatcaagcatcggg
caccacgcacactcttatgtttctgatatttttgacataatagaagtgctgtgggcgaac
cagcagctcatagagcttattcttgcgctcctcgaagaggtgagtattgtattggatttg
tctttaggaaactatggctcgcaatttttcctaaagtttgtaggtcttttcactgtgcta
aagtcatcccaggagataagtgactctgcaaagaagcttcttataagggcttgccggtct
gttgtggccctctcaagcctattctcaaaccacatacatttaattgtggaccttctttgc
tctgggattcgtaagcagaagctgggtaaagagctccgattcgctcttctggatactctc
tctcggcttactatttgcactaacctttcccgctttggagcaagcataatccatcctatc
ctcgaagtcatcatggaagcagatccttgtacgtctgtagagcataataagaatgcaaac
cccgagaagggtctgaatcctatgaacatagtttcttataaagcatttgaggtcctgcac
tttatttgcgctcagtttggcgtttctgtgactctttatattcctgtcattaccgagtgt
cttctgaaggttggctttacttctggtcttttggactccatcttttccttactactacga
cgcgaagaagttgatccagttactttttatcgcctgatttgtgagtggaagaaaaagcaa
gctaaaaaattctctgagtatacttccttggcttccttgttggccatgtatgagactcca
gttacacaagatacacttctttatatggagagcatctcaaacaaggtacctggcgacgat
aaagatgctatgattctggtcgttaaagatatcaacttcgatgatataggcagtgtgatt
aattatcttcacacatcatctacatggtttggggacgatatgcgcccgctcccggcaggc
gcgataggcgtgcatagcctttctattcaggaaaacgacatgcttaataagcacgtcacc
attcctcagcagatatggcgcgcagacacatgcaagaagaacgaagagtggcgtcattgg
ctttcaaatcttagcctgacccttctccaatgttctcctcttaaatgtctgcgggcatgc
cataagctggccacttcctatcctcgtgtagcacgtgatttatttaattactccttcctt
gcatgcctttctgagacataccccagcaataatgagcacaggaattatatcgttgagtct
atccggtctgtatttctatcacagaactgtccgctagatgttctacaaattttgctggat
ttggcagagttctgggagaacaggtcccgtgagttcagcaccacgttcagccacaatttc
ttgggagaggtagccgagcgatgccatgcgtatacgcgctctctgcgctacaaggaaaca
gagtatgcacaacacccgatagaggcagttggtcgtcttattgcaattaattatagttta
gggtatgaggagacggccatagggactctgagggttgagtgcaagcggcttaacttcatc
tctacaaacctaatctatgacatattgctacgttgcctatatacggggttggatgacgtt
ttcacaatgatgcaaagggaaggaggccttgagcctggggcagctgttaattgttcagca
gagtcaaccttggagcgtattatcaacaaggttgtttcgaaaattgtcacaaaggcttta
acagaagcgaagaaaatttccaatcttaaccagtccattccccagcaacttgtgtcttat
ggctcgataggtggcatatttgttgagggacggcccgtgatgtctgggccagagggcagc
gttcttcaggtagactataatgaaataggtatttatttaagcgcgctggcgcgaaggatg
ctaaaaagcaagcttacctatcaataccccacctttctgatgtatgaggaaaacctcttt
caatcagtgctcaagactcttcgctacaaggcacagggacacatgcaagatctctacggc
cccagtcctaagtggtttgaaaatgtgtgtctttgggacaaggctctttctgggtacaat
cgtcagatagatcagctaaagctaagcctcaagtctaatacatctgaggcacgaactcta
cttccgatgctcgttaacctcacgaaggataaaattcgttgcttgtttgcgcttgctgat
tactcggccgtccaggaagaagccgatcagttgctaaattacctgtcctctgaatctaaa
gaagaagcagggctcacaacagtaaaacatacactcatcaaaggatttcaagcagatatt
gcaacatatgctgcatggagtcttttggagcaagaccaagaggacgtggaaatctggctg
cgagtccttccagaagacaatatcgatggaacaattatacgtgccacatcgtatataaag
gcgaacaagatgttggaggcccataagttgctgtgcaagctccgtctacgtattgatccc
gatctgattggattgagtgcggaatcgtacacccgtgcgtataacctgtgtatcctctta
cagaccattactgaactccagaacataatctcgtataaactagctctcaacggactgaag
ttggatgcgccgtcgacgttaataaaggaaggaggcaatccttatgaaaacatttttgaa
acgactttgatttcattcaatccgcccccgggatttgctgacacagaaaaggaacgctta
cggttaatgtggtctcgaaagatctctatgattcgctgggactgcgagtcttgggaagct
ctccttcgggtcaggcggctcattatctttccaatcgaagatcaagaagtgtggattcgc
ttttcagttttgtgccttcagagtgggcgtgtgcagctagccagaaaaactctcgaaacg
ttcattaactcgtcatccgtgcatcacattaaagtctctaaaagccgaggactctacact
cttcttggtcttacttcgttcggcactcctcggcgctacctcaagcacgggtctggtgat
gtttctacgggaggaagcgtaacgcctattggctctgcacttggggccgagatgggagta
gtacaagatctcagcgcggttggctcatctcttgccaagtacctacttaaggatggcgtt
gtgaaagacgctttcactgctcagcagcatgtggctctaccaacttcggacgttctcagt
attgcttctcactctgttgctaagccgacgcttcagatgattgctaacgcttctactcac
caaggtcaaagcatcgagaaggaaactcctctgtcaatagttggccagcaatgcgatgat
gctaagcgcaatgcacagcgtgatctcttcaacgccctcataccgcctctcaatcatgtc
taccctcatgtgctatacgcctattgtaagcacctttgggtaagctcaaatgagaatgtg
ttagagaagctcgttgccttcacgcatctaatccgtctatgtaatgatgtctctatccaa
aaaacagagccaaaacttgtttgtcgtatgcttattcgtcttggggcctggtattccgac
ctgctaacgcctcttgatcacaagtcatgtagtatgatagggacaatatctccctcagaa
ggctatgtcaatattcctgtgcaggacacagtaaccagctgctctgctatatggaactct
atcgtgaacaactgtgatgccgatgctagcgtttgtagcactacgtatgaggcgaccgag
cattcagctgaacgtctagagctatcatctgcaagtacactagataaggcagtcgccaag
ttggttgacaacatattgctggcgtacgatgaactatcaaatgtatctctggaggaatgc
aatcagtacaatactgtaggcatgtcccgtataggccttatcgcgctggagtggtttcaa
gttgctgcagatcgcgatgaaacaagcaatcacatttggaaatgcatcagccacacaacg
tatgctattgttaacagctttgcggcttatattgacaagttgaatgatcgtcccggtgta
gatggcgggctacagatagtaacgcgtcgcagctctgttgacgccactagtgatgcagtt
gggagtacatcagaagcactcagtcagtctgttcaagatagcgacaggccactagtttgc
ccagagcaccttggcttcgtgcagaatcggcaagttcttttagaaaaggccaaactggag
taccttgtagaatctattatcgctcactttaagtgcatagagactgggcgctccatcgaa
gcgcttccaacgacgcttcgtctcatgacgctctggttccggtatggcagctatgacgag
gtagagacagaaataattaatggacttgctgcggtgccaattaatatctggctagacgta
ataccacagctcattgcacgccttcactcaccacagcataaaatacgacttcttgttcat
caattacttgttctcataggaacagagcatcctcaagcccttatctatccgttagttgtg
gctagtaagagtacgatcttaaaccgtcgcgtggagtccctaagcattgttgaccagatc
cgccgtactaatgaggcaatgatcttagagagccttaacataaataaggagcttcagcgg
gtggctatactgtggcctgaaatagcatacgatctcatcactcaagcatctacggcattc
tgtgaggagccaagagatctggtcaagttcttcaactatgcatgtcagctacagcttcta
gccagcaggaccccagagacacagtctgagtctgtcttcatacagatgtttagcagccag
cttcaagctgcgtgggatagctgtcgtcaatttcctgtgacaaacgaccttgtctgtctc
aacatcgtaatgaagcattacaaagaaatatacgacagaattcactctgaacttccgttt
ctaaatacgattgatctgctgcaaacctctcctcttctgtacaatatctccaataccaat
ctctgtgttcctggaagctaccatcctgcaagggctattaccacaatagtcaagttttat
cagaaggtttttgttattcgatcaaagcagagacctagaaaggttggtctggttgcatct
gacggagagtattatgcgtttctgctgaaaggacacgaagatctgcggcaggatgagcgg
gttatgcagctctttaccttaattaacaatttgttaatgaatgactcatactgttctcgc
cgcggtctgatggtcatgaagtatccaataacacccctgtcgcagaattcagggcttctg
tattgggtacctggatgcgacacaataatttctttaataaaggagtttcgccagctcaag
aggatccacttggagacggaaatgcagcagatcaagtaccgagctcctgcgttcatgaac
atggcactgcactacaaagtcgacgcattcaagtacatgctaacaacatctgacgcaatt
gatctctgcaggtcgttgtggaataaggcttcttcggcagaggattggctcctgaagaga
atgaattatacacgatccattgctgtgtcctccattgttggatatatccttggccttggt
gaccgtcaccccgctaacctaatgatagagcggacgaccggaatggtgctgcacatcgac
tatggcgattgcttcgaagttgccatgcacagggagcagctaccagagaaggttccattc
cgtttaacttcaattatgatgaaggcgtttgaaagctgtggaacggagggaagcttccgg
atgacaggagaggcgacgatgagcatattgaggtcgaacaaggacagcttggtaagtgtg
ctggaaacgttcatctatgatccgctgatgtccatgaaggttcttagtggagaaaataca
atgggtggaaaggaaaatatagatggaaacacagagttttatggaacaaggaggccggtg
caagaaagctatctcgaagggaacgagaggaacccgaaagcagtgaagattgttcagcgt
atctacgacaaactaacagggtacgatataaagtacatagatcgttctttgagcgtctct
gagcagatacaaagcctcatacacagtgcaacaaatgcggagaacctgtgccaactatat
attggatggtgtccatactggtga

DBGET integrated database retrieval system