KEGG   Giardia lamblia: GL50803_4405Help
Entry
GL50803_4405      CDS       T01047                                 

Definition
Kinase, TTK
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
gla  Giardia lamblia
Brite
Enzymes [BR:gla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     GL50803_4405
Protein kinases [BR:gla01001]
 Serine/threonine protein kinases: Other group
  TTK family
   GL50803_4405
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 684 aa AA seqDB search
MFGAPGSVPKDGDPPADRGYRPMRGYFNWTRDIAKEVPTTPDATEGDQEESSSSLADTKA
CVTPVGQNEVRGVAHPPKPSHLQRQHSSVQHVVAPLKKEAENTVIKKSPIFLEEPPQKKL
NYASYSTSSKRSSNDQSTKRSASPQTIDTAATKVLGLTQQMTILDNKEFQYNKTLGSTEV
KSETKVVVATTPPSEVLTPLVPTSSTPQSAAVQKKPSQSLRKGIFGQTDINYNTTIDFQS
GDAANTNIPLPPVTGQVLEKLPTKQVVYPCAPQVPDLQPVNTGSQQYRIPMVSLTSQNVT
YTTSNQPTMAGESRAAITAPSTRQNSDGTVARVHDIDDPDYTKALKFLEKYMSSLALLFR
KIPVQILYINKKVHLVIEQIGAGGYGHVYKALQPSGKLCAIKLLWSQKGNNYNEKEEKTN
YKAMIDEIEIMKRLKGKGICLDLVDCQVVTKHNPFLRRYALIVMELGDTDLRSFMKEFKS
VKRDRVVGPLHPCNLLPESKILSLLYDMITVLHRMHMQGYIHCDLKPQNFMFYKGRLRLI
DFGISKAMQQDTTCAVTDTIAGTPKYMAPEIMLTIGRTMDNKKTELHRVADVWSIGCILF
EMAAGYHPLDRYVDNHPLALLNTVAEKRYVIEADDLHVSPELRELILLCLEHSPKDRITM
EGIFAHACLKNQFSQNEVSEFQRS
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atgtttggtgcaccggggagcgtccccaaagacggagatccgccagcagacagggggtat
cggccaatgagaggctacttcaactggacccgtgatattgcaaaggaggtcccaacaact
ccggatgctacagagggcgaccaagaggagagtagtagctcacttgccgatacaaaggcc
tgtgtaactcctgtaggacagaatgaagtcagaggtgttgctcatcctccaaagccgagc
catttacaacgacagcacagctctgtgcagcacgtggtcgcaccattaaagaaagaggca
gagaatactgtgattaagaaaagtccaatctttctagaagaaccgccacagaagaaactc
aactatgcaagctacagcacaagtagcaagagatcgtctaatgaccaatcaaccaaaagg
tctgcatctcctcagaccatcgatacagctgcaactaaagttttagggcttacacagcag
atgactatcttagataataaggagttccagtataacaaaacactcgggtccacagaggta
aagtcagaaacaaaagtcgtcgtggccacaacacctccatctgaagtacttactccgctg
gtgcccacttcttcaacgccccaatcagctgcagtgcaaaagaaaccaagtcaatctctt
cgcaagggaatattcggccaaacagacataaactacaacactacaattgattttcaatct
ggcgacgccgccaatacaaatatccctcttccccccgttactgggcaggttttagaaaag
ctgccaacaaagcaagtggtttacccttgtgcgccgcaggtaccagacttgcagcccgtc
aacactggttctcagcagtatcgtattccaatggtcagtctaacgagccaaaatgtaaca
tacactacttcaaaccaaccaaccatggcaggcgagtctcgagcggccattactgcgcct
tcaacccgtcagaactccgacggaacagtcgcgcgcgtccatgacatcgacgaccctgat
tacacaaaagcgttgaagtttcttgaaaagtatatgagctcactagcccttttattcaga
aagatccctgtccaaatactttatataaataagaaggtccaccttgtaatagaacagatt
ggtgctggcgggtacgggcatgtctataaggcattgcaacccagcgggaagctctgcgcc
atcaagctgctgtggagtcaaaaggggaacaattataatgaaaaagaagaaaagaccaat
tataaagcaatgatagatgaaatagagattatgaagcggttgaaaggaaagggaatatgt
ctagatttagtggactgtcaagtagttactaaacacaatccttttctgcgacggtatgcc
ctgatcgtaatggagctgggagacacagatttaagaagctttatgaaggaatttaaatct
gtaaaaagggacagagttgttggacccctacacccttgcaacttgctccctgagagcaag
attctttctcttctctatgacatgataacagtacttcacaggatgcatatgcagggttat
atacattgcgatcttaagccccagaacttcatgttctacaagggccgcttgaggcttatt
gactttggcatatccaaagcaatgcaacaggacacaacctgtgccgtcacagacaccata
gctggcactccgaagtacatggctccggagataatgcttaccattggtagaactatggat
aataagaagacagaacttcacagagtcgcagatgtctggagcatcgggtgtatcttgttt
gaaatggctgctggataccacccgttggataggtacgtagataaccacccactggcactg
ctgaatactgtggccgaaaagaggtatgtcatagaggctgacgacctgcacgtttctcca
gagctaagagaacttatactgctatgcttagagcactctcccaaagaccgcataaccatg
gaagggatatttgcccatgcatgtctaaagaatcagttctcacagaatgaagtctctgag
ttccaacggtcttaa

DBGET integrated database retrieval system