KEGG   Giardia lamblia: GL50803_5358Help
Entry
GL50803_5358      CDS       T01047                                 

Definition
Aurora kinase
Orthology
K08850  
aurora kinase, other [EC:2.7.11.1]
Organism
gla  Giardia lamblia
Brite
Enzymes [BR:gla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     GL50803_5358
Protein kinases [BR:gla01001]
 Serine/threonine protein kinases: Other group
  Aur family [OT]
   GL50803_5358
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 311 aa AA seqDB search
MPQHLVPHTGTGKRTTIEDFEIGRFLGRGKYGLVYLAREQSSKLVVALKVLYKSYIKSER
VEGQVRRELDIHLNVRHINIIRLYTWFQDETRVFLVLEVAPYGELYQRLQQFGKFPLPVV
SKIIRDVAQAIQYLHRKNIFHRDLKAENILICKGKETKEHTDAHNSDDSISVHEHELVRM
AHYTYKIADFGWSVHHPTHGGRRRTQCGTLDYLPPEVMLGQSYDKACDIWSLGALCYELI
CGTAPFYHDEIKITRQNIANVEYSFTKDFSPASKDFIQRMLIRSPEARISIEDILRHPFL
RQTDHRSKVPK
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgccgcagcacttggtaccccacacagggacaggaaagcgcactacaatagaggacttt
gagattggacgctttcttggtcgtggaaagtatggcttggtttacctagcacgtgaacag
tcctccaagttggtggttgcccttaaagtgctgtataaatcctacatcaaatcggagcgt
gttgagggccaggtgcgcagggaattggatatacatcttaatgtgaggcacataaacata
attcgcttgtatacttggttccaggacgagacccgagtctttttggtcctcgaagtggct
ccgtacggcgagctttaccaaaggttacagcagttcgggaagtttcctctacccgttgta
agcaagattattcgagacgtggcacaggcgatacagtatcttcacagaaagaacatcttc
catagggaccttaaggcagaaaacatcttgatttgcaaggggaaagagaccaaagagcac
acagatgcgcacaattcagatgactccatttctgtgcatgaacacgagctagtccgaatg
gcacactacacatacaagattgcagactttggatggtccgtgcaccatccaacccacggt
ggccgacgacgcacccagtgcggaactctcgactaccttcccccggaggtcatgctcgga
caatcttatgataaggcttgcgatatctggtcactcggagccctgtgctatgagctcatc
tgtggcaccgcgcccttctaccacgacgaaatcaagatcacacgacaaaatatagccaac
gtagagtatagctttactaaggacttcagcccagccagcaaagatttcatccagcggatg
ttaattagaagcccagaggcccggatctccatagaggatatcctccggcatccattcctg
agacagacagatcacaggagtaaggtccccaagtag

DBGET integrated database retrieval system