KEGG   Giardia lamblia: GL50803_5533Help
Entry
GL50803_5533      CDS       T01047                                 

Definition
DUB-1
Orthology
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.1.2.15]
Organism
gla  Giardia lamblia
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 604 aa AA seqDB search
MHSAGFHVQDPAVSSQRFVPMPLKFIEKAIGQHEVSLGADQGLFKITIADQDSTCLTSDA
PRPTCYVTSPELVRDALSGPLLGPAELSKCFVVGMHNHGVTCYVNACIQMLQASVHAMKL
LISTQYRGLLAKDQLSRAVFSTLDDLRDAARSSHRSSGASYGTMYPKQIINQLPRFHMSP
YSMGDAYELLLLILDNISTAEIRVARADEYVPPNRDTTAIDQLFGQLQRTTISCSTCKKD
TISYSLTRSLQLPLNTSLYGAMKKYFRGSEVDGYRCEKCGQKTKISMVQNICNTPTIALF
CISRWDSYGMKNSQPCACPLELDMSRGLSRDIVEPLAPKHSKQKKHGKQRGSLASMLANP
DKHIGAPSTVTHRLVAMINHHGSTMNSGHYTAFVRDVTSGVWYLVDDSIVTRASEAEVSA
GTDAYVLLYEKADISVRGAAVAHEVIASVHEDEEILSSLPSSAQQNTKKTSTVAASSIVE
GNNPVDTPPRRSSKMCTDPSSLEKVLYPNKVETWTGEDLPPEILTAKAPNGELALVSDYL
HRGPDEMDAEIDRGRRRKTKAIREENHRQHTLEARKKKHERTQQWKKRIASRTIVNIFKR
IRKQ
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgcattctgccggcttccacgtacaggacccagctgtatcttcgcaacggtttgtccca
atgcctctcaagttcatcgagaaggctattgggcagcacgaagtttcgttgggagcagac
cagggcctttttaagattaccatcgcagaccaggactcgacgtgtctgacatccgatgct
cctcgtcccacgtgttatgtcacgtcccccgaactggtgcgtgatgctctttctggaccg
cttctcggacccgcggaattgtctaaatgctttgttgtcggaatgcacaaccatggcgtt
acatgctatgttaatgcatgcatccagatgttacaggctagcgtccatgcaatgaagttg
cttatcagcacgcaatatcgcggactactcgcaaaggatcagctttctcgtgctgttttc
agcacccttgacgatctccgtgatgcagccaggagctctcacaggagctccggtgcgtcg
tatgggacgatgtatcctaagcaaatcatcaaccaactgccgcgctttcacatgtctccg
tactcaatgggcgatgcttatgagcttcttctgctgatcctggacaatatttccactgca
gaaatccgagtagccagggcagatgagtacgttcccccaaatcgcgacacaacagcgatt
gatcagctattcgggcagctacaacgaacaacaatttcctgcagcacatgcaaaaaggat
actatcagctactctttgacacggtccctccagcttcctctgaacacctcgctctatggg
gcgatgaagaagtattttaggggcagcgaggtggacggatatcgatgtgaaaagtgtgga
cagaagacaaagatatctatggttcagaacatatgtaatacaccaacgattgcccttttc
tgcatttcgcggtgggacagctatggaatgaagaactctcagccatgtgcgtgtccgctg
gagcttgacatgtctcgaggtctgtcacgggatatagttgagcctcttgctccaaagcat
agcaaacagaagaagcacggtaagcagaggggttcgttggcaagcatgctagccaaccct
gacaaacatattggcgccccatccactgtgactcatcggcttgttgcaatgataaatcac
cacggttctaccatgaattcgggccactataccgcgtttgttcgagatgtcacctcgggg
gtctggtaccttgtggatgactcgatagtcacgcgggcatctgaggcagaagtttcagca
ggaaccgatgcatacgtgctactgtacgaaaaagcagacatatctgtaagaggggctgct
gtagctcacgaagttattgcatctgtacatgaggacgaggagatcttaagttccctaccc
tcctcagctcagcagaatacaaagaagacgtcaactgttgcggctagcagcattgtagaa
ggcaacaatccagttgacacaccccctaggaggagttctaagatgtgtaccgatccaagt
tcacttgagaaagtcctctatccaaacaaagtggaaacatggaccggcgaggaccttcca
ccagaaatattgacagccaaagcaccgaatggagaacttgcactggtaagcgactacttg
catagaggtcccgatgagatggacgccgaaattgatcgaggtaggcgtcggaaaactaaa
gctatcagagaagagaaccaccggcaacacacgctcgaggcaagaaagaaaaaacacgag
cggacgcagcagtggaagaaaaggattgcttcgcgtacgatagttaatatatttaagaga
atacgcaagcagtag

DBGET integrated database retrieval system