KEGG   Giardia lamblia: GL50803_7203Help
Entry
GL50803_7203      CDS       T01047                                 

Definition
Guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
gla  Giardia lamblia
Pathway
Purine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gla00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    GL50803_7203
Enzymes [BR:gla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     GL50803_7203
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 205 aa AA seqDB search
MQTRCFRPTQNKIIVLNGPSGSGKSTLFRAITTMDRYKDYFGFSVSHTTRAPRPGERDGI
DYYFVSHEQFQSLREQGGFLETVENFGNFYGTSFAAINDVLKRQHCILDIDYRGAMTLNA
VLEQERNVKALFVFISPPSVELLEQRLRGRQTESEEQIKKRLDTALRELDFFNANRSFYD
VHIINDNLEEAIQTLDLSVRRFLSG
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgcagacgcgctgcttcaggcccacgcagaacaaaattattgtcctcaacgggccgtca
ggaagcggaaaatcaaccctctttagggccatcacgacaatggatcgatacaaggactat
tttggattctccgtttcacatactactagggcgcccaggccaggagagcgcgatggcatc
gactattattttgtctctcatgagcaatttcagagcctgagggaacagggtggcttcttg
gagaccgtcgagaattttggaaatttctatggaacgtcgtttgctgccatcaacgatgtt
ctgaagagacagcattgcatcctcgacattgactaccggggtgcaatgacactaaacgcc
gttcttgagcaggaaaggaacgtgaaagctctctttgttttcatcagcccaccatctgtt
gagctcctggagcagaggcttcgcggccgccagactgagagtgaagagcagatcaaaaag
cgtcttgataccgccctgcgcgagctagacttctttaatgctaacagaagcttttatgac
gtccacataatcaatgacaatctcgaggaagccatccagaccctcgacctctcggtgcgg
agattcctctcggggtga

DBGET integrated database retrieval system