KEGG   Giardia lamblia: GL50803_7203Help
Entry
GL50803_7203      CDS       T01047                                 

Definition
Guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
gla  Giardia lamblia
Pathway
Purine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:gla00230]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 205 aa AA seqDB search
MQTRCFRPTQNKIIVLNGPSGSGKSTLFRAITTMDRYKDYFGFSVSHTTRAPRPGERDGI
DYYFVSHEQFQSLREQGGFLETVENFGNFYGTSFAAINDVLKRQHCILDIDYRGAMTLNA
VLEQERNVKALFVFISPPSVELLEQRLRGRQTESEEQIKKRLDTALRELDFFNANRSFYD
VHIINDNLEEAIQTLDLSVRRFLSG
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgcagacgcgctgcttcaggcccacgcagaacaaaattattgtcctcaacgggccgtca
ggaagcggaaaatcaaccctctttagggccatcacgacaatggatcgatacaaggactat
tttggattctccgtttcacatactactagggcgcccaggccaggagagcgcgatggcatc
gactattattttgtctctcatgagcaatttcagagcctgagggaacagggtggcttcttg
gagaccgtcgagaattttggaaatttctatggaacgtcgtttgctgccatcaacgatgtt
ctgaagagacagcattgcatcctcgacattgactaccggggtgcaatgacactaaacgcc
gttcttgagcaggaaaggaacgtgaaagctctctttgttttcatcagcccaccatctgtt
gagctcctggagcagaggcttcgcggccgccagactgagagtgaagagcagatcaaaaag
cgtcttgataccgccctgcgcgagctagacttctttaatgctaacagaagcttttatgac
gtccacataatcaatgacaatctcgaggaagccatccagaccctcgacctctcggtgcgg
agattcctctcggggtga

DBGET integrated database retrieval system