KEGG   Giardia lamblia: GL50803_7990Help
Entry
GL50803_7990      CDS       T01047                                 

Definition
Translation elongation factor
Orthology
K03259  
translation initiation factor 4E
Organism
gla  Giardia lamblia
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:gla00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    GL50803_7990
Translation factors [BR:gla03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    GL50803_7990
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 168 aa AA seqDB search
MEDIILDDEWTLFFSNQDRHGDQSHLADFMDNIHPIMTTDSLKAFFNCYQFLRRPNVIDC
NQGYHFFKKGIRPAFEDPAHVKCIRIKIMIASGYASMVWEYLLMMIFRGLLDECPKVTGI
EFRRGKVVANEFIAIWMRDKTDEDQKNLLAILKREFNLQDTSMFHIQP
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atggaggacattatacttgacgacgagtggacgcttttcttttcaaatcaggaccggcac
ggggatcaaagccatctagcagactttatggacaacatacacccgataatgacgacggac
tcccttaaggccttcttcaattgctatcagtttttgcgtcggcccaacgttattgactgt
aatcaggggtaccacttcttcaagaagggaatccgaccggctttcgaggatcctgcgcat
gtcaaatgcatcaggatcaagataatgatcgcgtcgggctatgcatccatggtgtgggag
tatttactaatgatgattttcaggggccttttggacgagtgcccgaaggtcaccggaata
gagttccgcagggggaaggttgttgcaaatgagtttatcgccatttggatgcgtgacaag
accgatgaggaccagaaaaacctgctggccatcctgaagagggaattcaatctccaggac
accagcatgttccacatccagccatga

DBGET integrated database retrieval system