KEGG   Giardia lamblia: GL50803_8173Help
Entry
GL50803_8173      CDS       T01047                                 

Definition
Glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
gla  Giardia lamblia
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:gla00561]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 540 aa AA seqDB search
MATNSYLLAIDQGTTSTRVILFDRAGKNVASSTRPNYSITPNEGWVEQDPKRIVGDVYAC
LNDVSGKAQELGIQRDSIKACGITTQRETMVIWDGSTGEPLYNAIVWSDARNHELLTELE
KTYGPIIRIRTGLPLSTYFTAGKVLWLYRNVPTVKKAIKNCTAKIGTMDTWLLWNLSKEK
SYLTDVTAASRTQFFNIETMAWDPMLLHIFSVSTEVLPVVWPSAGRIFGTLSETAGWLEG
LQIGGMIGDQQASMVGHRCFTTGSSKITFGTGAFLLINAGTTKPEPNDNLLITICYQESP
TARPVYAREASIASAGSIFEWLRTMGMITSVTDIDSLVKPLLDETSSVVFVPAFTGLLCP
FWCPHARAGIFNLSYSTTPSHIVKAAMEAVALQIRDILPLFQELNNVPNALNIGVAMARI
NSQNSLSEAMAIEALDQSGDLTLPTNSGRQIRIDGGLTKSEHFSQILSDVTQCAILVSRD
QELTSLGCVIMAGLTLQIYKDLSDAEASIGSSFSLFSPKRSASQAAELYNKWQVAIKKTM
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgaatagctatctactcgccatcgatcagggaacaacatcgacccgggtgatt
ttgtttgacagggcggggaaaaacgttgcatcctctactcgtccaaactattcgataact
ccaaacgaaggctgggtggagcaggaccccaagcgaattgtcggcgatgtctacgcgtgt
ttgaatgatgtctcaggcaaggcccaggagcttggaattcagcgggattccatcaaagca
tgcgggattacgacacagcgtgaaacgatggttatctgggacggatctactggggagcct
ctctacaacgcaattgtttggtctgatgcacggaaccacgagcttcttactgagttggaa
aagacgtacgggccgatcattcgcatcagaacagggcttcccctgtcaacctacttcaca
gccgggaaggttctatggctctatcgaaacgttccaacagtcaagaaggccatcaagaac
tgcactgctaaaataggaaccatggatacgtggctcctctggaatctgagcaaggagaaa
tcctatctcacagatgtgactgcagcgtcgcggactcagttctttaacatcgaaaccatg
gcatgggatccgatgctgcttcacattttctctgtttccactgaagttcttccggtggtc
tggccatctgcagggaggatatttggcaccctgtcggaaaccgctggctggcttgaaggg
ctccagataggtggtatgataggagaccagcaggcgagtatggtggggcacagatgcttc
acaaccggttcatccaagattacttttggaacgggcgctttcctgcttataaacgcaggg
actaccaaaccagagcccaacgataatctccttatcacgatttgttaccaggaatctcct
acagcacggcccgtctacgcccgcgaggccagcattgcaagtgctgggtccatatttgag
tggctgagaacaatgggtatgataacatctgttacagacattgattcattggtcaaaccc
ctgctagacgagacctcctctgtcgtttttgtccccgcgtttacagggcttctctgtccg
ttctggtgtccccatgctcgagcgggcatatttaatttatcgtactcaacaacgccctcc
cacattgttaaagcagcgatggaggctgttgcgttgcagatccgggacattctccctctt
ttccaggagctcaataacgtgccgaacgctttgaatataggtgtggccatggctcgcata
aatagtcaaaacagtctttcagaggccatggccatagaggcgctggatcagtctggcgac
ctcacacttccgactaactctgggaggcagattcgcattgatggtggcttgactaagtcg
gagcatttctcacaaatcctctcggatgtgacacagtgtgcaatcctggtatctagagat
caagaactcacgtctcttggttgtgtgatcatggctggccttacattgcagatttacaaa
gatttatctgacgcagaggccagtataggctcctccttcagtctattttctcctaagaga
tcagcgtcccaggcagcagagctctataataagtggcaggttgcaatcaaaaagacaatg
taa

DBGET integrated database retrieval system