KEGG   Giardia lamblia: GL50803_8978Help
Entry
GL50803_8978      CDS       T01047                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
gla  Giardia lamblia
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:gla00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1215 aa AA seqDB search
MSFIFPLQLLYKAGRKTMDHALRVNIRFVVDNYVAHPTQRLALLSSFAKEPMVFMRRNGP
LWELDLDITDTLERLSEDRADTEDMRAYRYAVINEDGSQSPDVLKRILPNIPPTQSIYDQ
CISALVLHPQYESLVNNSGNVLDVSFTLVDDWSFSSSSPWNTSAMKVMIGHDLKVDKSVL
DSGHLLNKLFNRCFWKIDDSLDMTDSATTSILKDATIHHGAPEKLAILKVSKVVKEVENK
KAIAKLSRSNLVQSNLVPVLFACMVPYVFKGERVLLTGNLPRFGNWNPRSRSSIIFNHVG
ERRFEAPTVFYFTVDELKTFLFKFAIVHADGNISFESGENRSIHLSETFSMTATYTLGDE
SVHRTLPYKTVGDLYAAAAASATTSTTTTASSPGQKDDQEVEDNNNSSEVKLLSSAPSTA
KKGNSHLKTVTIRYWSYFICGFFRYPYSAVPRFTSLCVPLFSLRSALSTGVGDFGDLRML
VNFAKCCGFNIIQLLPLQDTITGPILSPSGTNTIKSHFSAGDSSPYAGISVFALHPIYIR
CEKISGMDSVVTRKLNDFRHHMTRDISYLHCRYNYGKVCREKLNFLYLIYSYICDTAGLH
TLVKDIVTWIQSSPLIEYWIYSYMLYRYFIDVFEGLSFLDPSTDMSARNPLLKRFYDAIK
PANISALTPTDSCLYIKTLYDKISSGASPSSTVTKEIGKEVVSTTKHIFFYAFLQMHAHT
QLQDSAMYCRSRGICLKGDLSFGTSPVGVDSWVYPEYFEKSRVVGAPPDAFTPMGQNWGY
PAYNWRKMEEIDGYQWMQRRLKHAELFFDCVRLDHILGLFRTWELPLTAGKNNGSLGQFV
PAAPLHWDWIFEECYDPNSSISWCRSKSDIRTRLTQPLLKRDLAHKLAGHAAGDLACSTL
VEFGVLSYDKRTDSYVIELQEQKACALLDSLLLNEDIALELHSALMETYRKLLGNVCLLN
DVSNPDAFCHPVFTNRHVSSEAVSLTSLEHIGLRDKIRHWSYEYFTTWHNDEWTRSGTKH
LRLIKESTNMMICGEDLGYLHPCIRRVMADLGIIGLRVQRMTHEGYPGHFYRCDDESVYS
YLTVAAPSTHDTYPLRAWWEHNRSAACAFWRENLGRAGDSDWQVSRSLSEFDCRAILRQN
LHSRSIICCLMLQDIFGACDKYRYNGDTKDEIINMPGASEWQWKYRIHISLEELHNSDLV
GIIGDEICNSGRILQ
NT seq 3648 nt NT seq  +upstreamnt  +downstreamnt
atgtcatttatttttccactacagctactctacaaagctggaagaaaaacaatggatcac
gcactcagggtcaatatccgcttcgtggtagacaactacgtggcgcaccccacacagcgc
ctagctctcctgtcttcctttgcaaaggaaccaatggtttttatgcgtagaaacgggcct
ctgtgggagctagacctggatattacagacaccttggagaggctttcagaagatcgtgca
gacacagaggatatgcgagcgtacaggtatgccgtcatcaatgaagatgggtctcagtcc
cccgatgtgctgaagcgtattctaccgaacattccccccactcaatcaatctatgatcaa
tgcatctcagccttagtgttgcatcctcagtatgagtcacttgtcaacaacagcggaaat
gtccttgacgtgagctttaccctggtggatgactggagcttcagttccagcagcccttgg
aatacctctgcgatgaaggtcatgattggtcacgacctcaaggtggacaaaagcgttcta
gatagcggacacctactaaataagcttttcaacagatgtttttggaagattgatgactcc
ctggacatgacagactctgcaaccacatcgatactgaaggacgccaccatacaccacggg
gcacctgagaagctagcgattctaaaggtaagtaaagtcgttaaggaggtcgagaataag
aaggcaatagcaaagctgagtaggtctaatctcgttcagtccaacctagtccccgtgttg
tttgcatgcatggtgccatacgtcttcaagggcgagcgcgtactattgactggtaatctg
ccccgtttcggtaactggaacccccgctccaggagctccataatattcaaccatgtggga
gagcgtagatttgaagccccaactgtcttctactttacagtagacgagctaaaaaccttc
cttttcaagtttgccatcgtccatgcagatggaaacatctctttcgaaagtggagaaaac
cgatcaatacatctatctgagactttctcgatgacagctacatacaccctgggcgacgag
tctgtgcataggacacttccatacaagaccgtcggtgatctttatgcggccgcagccgca
tctgcgaccacatctacaaccacgacagcatcttctccgggtcaaaaggacgatcaagaa
gttgaagacaataacaatagtagtgaggtcaagctgcttagttctgccccttctactgct
aaaaagggcaatagccacctcaagactgtgacgataaggtattggtcgtacttcatttgc
ggatttttccggtatccatacagtgcagtaccgcggttcacatctctctgcgtgcctctt
ttcagcctccgctctgcactctccactggtgttggggacttcggtgatctgcgcatgctt
gtcaacttcgccaagtgctgcgggttcaacataatacagcttcttccccttcaggacact
ataaccggcccaatcttatccccctcaggtaccaacacgattaagagccatttctcggcg
ggggattcttcaccatatgcgggcatttctgtctttgctcttcatcccatctatataagg
tgcgaaaagatctccggaatggatagtgtagtaacacggaagcttaatgacttccgccac
catatgacgagggacatatcttatctccactgtaggtacaactatggcaaggtgtgcaga
gaaaagctgaactttttgtatttaatatactcttacatctgtgacaccgcaggcctgcat
acactagtgaaggatattgtcacgtggattcagagcagcccactaatcgagtactggata
tatagttacatgctgtaccgctactttatcgacgtttttgaggggttgagtttcctggac
ccatccactgacatgtctgcaagaaatcctcttttgaagcgtttctatgatgcaataaag
ccagcaaacatctctgcacttacaccaaccgatagctgcctgtacattaagaccctgtat
gataagatctcctctggggcctccccttcatctacagtaactaaggagataggcaaggaa
gtagtgagcactacgaagcacatattcttttatgcctttcttcagatgcatgctcacaca
cagttacaggactctgctatgtactgccggtccagaggcatatgtctcaagggcgacttg
agctttggcacgtccccggtcggcgtagattcctgggtgtacccagaatactttgagaag
agccgtgttgttggtgcgccacccgacgcatttacgccaatgggtcagaactggggctat
ccggcatacaactggcgcaagatggaggagattgacgggtatcaatggatgcagagacgc
ctcaagcacgcagagctgttcttcgattgcgtgcgcctggatcatattctcgggctgttt
cgcacgtgggaattgccgcttactgcagggaagaataatggatctctgggacagtttgtt
cctgcagctcctctgcactgggattggatatttgaagagtgctatgaccccaactcaagt
atttcgtggtgtcgcagcaagagcgacatacgtacacgtcttacgcagcctctcctcaag
cgtgatctggcgcacaaacttgctggtcacgcagccggcgacttggcgtgctcaacactc
gttgagtttggagtacttagttatgacaaacgaacggattcttacgtgatagagctacaa
gagcaaaaggcctgcgcgctgctagatagcctcttgcttaatgaagatattgcactagaa
ttgcactctgcattgatggaaacgtatagaaagctactagggaatgtctgtcttttaaac
gatgtctccaacccagacgctttctgccaccctgtattcacgaatagacatgtgtccagc
gaggcagtgtctcttactagccttgagcatatcgggctccgcgataagataagacattgg
agctatgagtacttcactacctggcacaacgacgagtggaccagaagcggcacaaagcac
ctgcggctcataaaggagtccacgaacatgatgatttgcggagaggatcttgggtacttg
cacccctgcatccgtcgggtcatggccgacctaggaatcatcgggctcagagttcaacga
atgacccacgaaggttatcctggacacttttatcgttgtgatgacgagagtgtttactcg
taccttacggtggctgctccatcgacacatgacacgtacccacttcgtgcttggtgggag
cataatcgttccgctgcatgcgcattctggagagaaaacttgggccgtgcgggagacagc
gattggcaagtttcccgttcactttctgagttcgactgtcgcgctatcctccgtcagaat
ctgcactccaggtccatcatatgctgcctgatgctgcaggacatatttggggcgtgcgac
aagtacagatataacggagacacaaaggacgagataataaacatgcccggagcaagcgag
tggcagtggaagtatcgcattcacatcagcttggaagagcttcacaacagcgaccttgtt
gggatcatcggtgacgagatctgcaattctggtcgcattctgcagtga

DBGET integrated database retrieval system