KEGG   Giardia lamblia: GL50803_9130Help
Entry
GL50803_9130      CDS       T01047                                 

Definition
Histone methyltransferase HMT1
Orthology
K11423  
histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
gla  Giardia lamblia
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:gla00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    GL50803_9130
Enzymes [BR:gla01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     GL50803_9130
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 298 aa AA seqDB search
MGKVMAMKQGDKLPTAREPLRVFPYVYKRDELAKMRRVFASAIHITEMDAVSLHYTHVKR
NIYVGCKRPSAARKTFCTCTCKEGTGCGTSCELRKVHLECYKECCAGSPCSKQFIVRPLF
GNSIDLPKDATTLHKDNSRLADCGNQRLQRMQYARTAVYPAGRKGYGLFALTSIQRGALV
TEYIGEVITREECMRRKKSAKGHLYFLALDRELYIDAAHKGNESRFINHSCDPNCEVQLW
YVGEEPRAAIVALRSIAPHEELSFDYKFDFYPGVKPKYPCFCGSLYCRGYIDAPKLRT
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaagtaatggcaatgaagcaaggagacaagctacctacggccagagagcctttg
cgcgtctttccttatgtgtacaaaagggatgaactggctaaaatgcgccgggtcttcgct
tctgcaatacacatcacagagatggatgccgtctccctccattacactcacgtcaaaagg
aatatatatgtagggtgcaagcgccctagcgcggcacggaagacgttctgtacttgtacg
tgcaaagaaggaactggatgtgggacaagctgtgagctcaggaaggttcatcttgagtgc
tacaaagagtgctgcgcaggatcgccatgctccaagcaatttatagtcagacccttgttt
ggtaactctatagatcttccaaaagacgctacgacacttcataaagataacagtaggctt
gccgactgtggaaaccaaaggcttcagaggatgcagtacgctcggacagctgtctatccg
gctgggaggaaaggctatggtctgtttgcacttactagcattcagcgaggagcgctcgtg
acagaatacataggtgaggttataacaagggaagagtgcatgcggcggaagaagagcgcg
aaggggcacttgtactttcttgctttagacagagaactctacatagacgctgcccataaa
ggaaatgagagtcggtttatcaaccattcttgtgaccctaactgtgaggtgcagctatgg
tatgtcggcgaggagccaagagctgccatagttgccctacggagtattgctccccatgaa
gagcttagcttcgattataagtttgacttttaccccggcgtgaagcctaaatacccgtgt
ttctgcggctcgctctattgtagagggtacatagatgcaccaaagttaaggacatga

DBGET integrated database retrieval system