KEGG   Giardia lamblia: GL50803_92741Help
Entry
GL50803_92741     CDS       T01047                                 

Definition
Kinase, CMGC CLK
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
gla  Giardia lamblia
Brite
Enzymes [BR:gla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     GL50803_92741
Protein kinases [BR:gla01001]
 Serine/threonine protein kinases: CMGC group
  CLK family
   GL50803_92741
Spliceosome [BR:gla03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    GL50803_92741
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 444 aa AA seqDB search
MALSSRPNTARRSSARSGALGPDTSTQNLEEGHINPGPNEVLGGRYAIFARLGHGTFGRV
YACYDKSRDDTEVAVKVIRAIDRYTAAGKAEEAVLNKIKQAAKKAQHTGYSSSLMNSYYA
KLCWNNCNLAYLERSFQHNNHICLVFPKYGISLLDLLKANNFRGFNIDWTRELSRSFMVG
VGFLHDLGYIHTDIKLENILSREKPRATRVRDRIFVHPSGAELVLIDLGSSVRLSDHRRP
SLVCTRQYRPPEAYLGLPFDQTLDIWSCGCVIFEILTGRTLFRTHNSVVHLCMMERLLGP
MPDTVIEQMDIYNSKYQEFFCRTKKSWSLPTDLDPQERRHYEELLPLEREIDKYGYGYHT
SLIHLLRVMLSWDARKRFSVPECMAHPFFEEEPRESKQTQTSGRNLANDQNMGTLMRDLL
SAIDRTHPRYNDLKNAVDIAFGIN
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggcactgtcttcacgcccaaataccgcccgccgaagctccgcaaggtctggtgctttg
gggccagacacgtcaacgcaaaatcttgaggaggggcacatcaatccggggcccaacgaa
gttctcggtggccgctatgccatatttgctaggctcggccacggaacgtttgggcgtgtc
tatgcgtgctatgataagtctcgcgacgatacagaggtcgccgttaaggtcattcgcgcc
atagacagatacacggcggcgggaaaagccgaggaggcagtgctgaataaaattaagcag
gcagcgaaaaaagcccagcatacaggctactcgtctagcctaatgaatagctattatgca
aagctttgttggaataattgcaatctagcatacttggaaaggagcttccagcataacaat
cacatttgccttgtctttccgaaatatggcatcagcctccttgatctacttaaagcaaat
aattttcgaggattcaatattgactggacgcgggaactcagccgtagcttcatggttggt
gtggggtttcttcatgacctcggatatatacacacagacattaagctggagaatatcctt
tcgcgagagaagccccgcgccacccgtgtgcgtgatcggatatttgtgcatccctctggt
gcagagcttgtgttgattgacctggggtcgagtgttagattaagtgaccacagacgtcca
tcccttgtctgcacccgacagtatagacccccggaggcatatcttggcttacccttcgat
cagactttggacatctggtcttgcggatgcgtgatcttcgagatcctgactggacgcact
ctttttcgtactcacaattctgtcgttcatctatgtatgatggagaggctcctgggtcct
atgcccgatacggttattgagcagatggacatttataactctaaataccaggagttcttc
tgtagaacaaagaagtcgtggtctcttcctaccgacctcgatcctcaggagcgaaggcac
tacgaggagctccttcctcttgagcgtgagattgacaaatatggatacgggtatcatacg
tctcttattcacttgttgagagtgatgctcagttgggacgcgcgcaagaggttctccgta
ccggagtgcatggcacaccccttcttcgaggaagagccccgtgaatctaaacagacacag
acgtcggggaggaatcttgctaacgatcagaacatggggactttgatgcgtgaccttttg
tcggcaatcgatagaacccatccccgctacaatgatctaaagaatgcagtcgatattgct
ttcgggataaattaa

DBGET integrated database retrieval system