KEGG   Giardia lamblia: GL50803_93938Help
Entry
GL50803_93938     CDS       T01047                                 

Definition
Triosephosphate isomerase, cytosolic (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
gla  Giardia lamblia
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gla00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GL50803_93938
   01230 Biosynthesis of amino acids
    GL50803_93938
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GL50803_93938
   00051 Fructose and mannose metabolism
    GL50803_93938
   00562 Inositol phosphate metabolism
    GL50803_93938
Enzymes [BR:gla01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     GL50803_93938
Exosome [BR:gla04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   GL50803_93938
  Exosomal proteins of bladder cancer cells
   GL50803_93938
  Exosomal proteins of melanoma cells
   GL50803_93938
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
AA seq 257 aa AA seqDB search
MPARRPFIGGNFKCNGSLDFIKSHVAAIAAHKIPDSVDVVIAPSAVHLSTAIAANTSKQL
RIAAQNVYLEGNGAWTGETSVEMLQDMGLKHVIVGHSERRRIMGETDEQSAKKAKRALEK
GMTVIFCVGETLDERKANRTMEVNIAQLEALGKELGESKMLWKEVVIAYEPVWSIGTGVV
ATPEQAEEVHVGLRKWFAEKVCAEGAQHIRIIYGGSANGSNCEKLGQCPNIDGFLVGGAS
LKPEFMTMIDILTKTRT
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgcctgctcgtcgccccttcatcggcggtaacttcaagtgtaacggctctcttgacttt
atcaagagccacgtggcggcaattgctgcccataagatccctgattccgtggacgtcgtc
attgccccttccgccgtacacctgtcaacagccattgcggcaaacacgtcaaaacagttg
aggatagcagcgcagaatgtgtacctagaggggaacggggcgtggactggcgagacaagt
gttgagatgcttcaggacatgggtttgaagcatgtgatagtagggcactctgaaagacgc
agaatcatgggggagaccgacgagcaaagcgccaagaaggctaagcgtgccctggaaaag
gggatgacggtcatcttctgcgtcggagagaccttggacgagcgcaaggccaaccgcacc
atggaggtgaacatcgcccagcttgaggcgcttggcaaggagctcggagagtccaagatg
ctctggaaggaggttgtcattgcttacgagcccgtgtggtccattggcacgggcgtggtg
gccacgcccgagcaggcagaggaggtccatgtggggctccgaaagtggtttgcggagaag
gtttgtgccgagggcgcacagcatatccgtatcatttacgggggatcggccaatggaagc
aactgcgagaagcttggccagtgtccgaatattgacggcttccttgtcggtggcgcttcc
ctcaagccggagtttatgacgatgatcgacattcttacgaagacccgtacatag

DBGET integrated database retrieval system