KEGG   Giardia lamblia: GL50803_9413Help
Entry
GL50803_9413      CDS       T01047                                 

Definition
Protein disulfide isomerase PDI2
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
gla  Giardia lamblia
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:gla00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    GL50803_9413
Enzymes [BR:gla01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     GL50803_9413
Exosome [BR:gla04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   GL50803_9413
  Exosomal proteins of colorectal cancer cells
   GL50803_9413
  Exosomal proteins of bladder cancer cells
   GL50803_9413
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 449 aa AA seqDB search
MVLGLLCTLALLGSVSAEVLVLTQDNFKSELEKHKNLFVKFYAPWCGHCKQLAPTWEEMS
GEFSVMPVAEVDCTTHTEICGKYGVNGYPTIKLLQSNGAVMDYDGPREKQSMMQWAEAML
KPALVEYNDINDIKDKASKTSQPDIYYVMEGPQLLDKFEDFFTPMKGKHFFGFLKSAKEK
LYVMREGVKLDFKGKFDKASVQAFLQDNRFPFFPELGPSNFQDLLKRPGRLLTFLAIDPS
EHEDTRSKLASFARKLQTGVADLDSKFVNDYYTLTSIDGVQWAQFMEQFEIKKEDLPQLV
VYDVLAGSKKYFKASIGDSVVEDVTAFLRKHKSGAVPPSYMDKEEAKAAKKTAQGEEYTP
SGGNIADRIMEYMNTMLNENFALFVAMVLIGSAIVMSLVVGCCCTGKKKRTPKKSPPKTA
KRDSESTDPKQSPKKASAVNKPAQEKRKK
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atggttcttggacttctctgtacacttgcgctccttggctctgtgagcgcagaggtcttg
gttctcacgcaagacaacttcaagagcgagcttgagaagcacaagaacctctttgtaaag
ttctacgctccgtggtgtggacactgcaagcagttggctcctacctgggaggagatgtct
ggggaattctctgtgatgcccgtggctgaggttgactgcactacgcacacggagatctgc
gggaagtacggcgtcaatggctatccgaccatcaagctcctgcagagtaatggggcagtg
atggactacgacggccccagggagaagcagagcatgatgcagtgggccgaggcgatgctc
aagcccgcgcttgtggagtacaacgatatcaatgacatcaaggacaaagcctcgaagacg
tcgcagcccgacatctactacgtcatggaaggccctcagctcctcgataaatttgaggac
ttctttacacccatgaagggaaagcatttctttggattcctcaaaagcgcgaaggagaag
ctctatgtgatgcgcgaaggtgtgaagctagacttcaagggcaagttcgacaaggcctct
gtccaggcctttctgcaagataacaggttccccttcttccctgagctcgggcctagcaac
ttccaggaccttctcaagaggcctggccgtcttctgacttttctcgcgattgatccctct
gagcatgaagacacgcgtagcaagctcgccagctttgcacgtaagctccagaccggtgtt
gcagatttggattctaagtttgtcaacgactattacacattgacgtccatcgatggggtg
cagtgggcgcagttcatggaacagtttgagatcaagaaggaagacttgccccagctggtc
gtttatgacgttcttgcaggcagcaagaagtacttcaaggcatccattggtgactcagtg
gttgaggacgtcacggcgttcctccgcaagcacaagtctggggctgtcccgccttcctat
atggacaaggaggaggccaaggccgccaaaaagacggcccagggcgaggagtacacccca
tctggaggcaatattgctgaccgcatcatggagtacatgaacacaatgctcaatgagaac
ttcgcgctcttcgtcgccatggtccttatagggtcggccatcgtcatgagcctggtcgtc
gggtgttgctgcacgggcaagaagaagagaactccgaagaagagccccccgaagaccgcc
aagagggacagcgagagcacggacccgaagcagagccccaaaaaggcctctgccgtcaac
aagcctgcgcaggagaagcgcaagaagtaa

DBGET integrated database retrieval system