KEGG   Gloeobacter kilaueensis: GKIL_0667Help
Entry
GKIL_0667         CDS       T02885                                 

Gene name
rbcS
Definition
ribulose-bisphosphate carboxylase (EC:4.1.1.39)
Orthology
K01602  
ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
glj  Gloeobacter kilaueensis
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:glj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GKIL_0667 (rbcS)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    GKIL_0667 (rbcS)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    GKIL_0667 (rbcS)
Enzymes [BR:glj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     GKIL_0667 (rbcS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(713042..713362)
Genome map
AA seq 106 aa AA seqDB search
MQTLPKQRRYETLSYLPPLSDAQIGRQIQYMLDKGYIPAIEFNETSDPTEYYWTLWKLPL
FGAQSVQDVLTEVRACRDSYPKNFIRVVGFDNVRQCQTVSFIVYKP
NT seq 321 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacgcttcccaaacaaaggcgctacgagacactgtcctatctgccgcccctctca
gacgcgcagatcggtcgccagatccagtacatgctcgacaagggctatatccctgctatc
gagttcaacgaaaccagcgacccgaccgagtactactggacgctctggaagttgccgctt
tttggtgcccagagcgtgcaggatgttcttaccgaggtccgcgcctgccgcgattcctat
ccgaagaacttcatccgcgtcgtcggcttcgacaatgtccggcagtgccagacggtgagc
tttattgtctacaagccttga

DBGET integrated database retrieval system