KEGG   Gloeobacter sp. JS: GKIL_0669Help
Entry
GKIL_0669         CDS       T02885                                 

Gene name
rbcL
Definition
ribulose bisophosphate carboxylase (EC:4.1.1.39)
Orthology
K01601  
ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
glj  Gloeobacter sp. JS
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Oxygenic photosynthesis in plants and cyanobacteria
Class
Metabolism; Overview; Carbon metabolism [PATH:glj01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:glj00630]
Metabolism; Energy metabolism; Carbon fixation in photosynthetic organisms [PATH:glj00710]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(713821..715245)
Genome map
AA seq 474 aa AA seqDB search
MTYTQTKPKTGYQAGVKDYRLTYYMPDYIPRDTDVLAAFRVTPQPGVPIEEAAAAVAAES
STGTWTTVWTDNLTDLDRYKGRAYDIEPVPGESNQFICYVAYPLDLFEEGSITNLLTSLV
GNVFGFKALKALRLEDIRFPIALVKTYPGPPHGIVVERDKLNKYGRPLLGCTIKPKLGLS
AKNYGRAVYECLRGGLDLTKDDENINSQPFMRWRDRFLFVQEAINKAQAETGEIKGHYLN
VTAGTCEDMMERAEFAKEIGSPVVMHDYLTGGFTANTTLSKWCRRNGMLLHIHRAMHAVI
DRQKNHGIHFRVLAKCLRLSGGDHIHTGTVVGKLEGDRAATLGFVDLLREDHIERDLSRG
IYFTQDYASMGGVMAVASGGIHVWHMPALVEIFGDDSILQFGGGTLGHPWGNAPGATANR
VALEACVQARNEGRNLMREGGDIIREAARWSPELAAACELWKEIKFEYETVDTL
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
gtgacgtacacgcagacgaagcccaagacaggttatcaggcaggtgtgaaggattaccgc
ctcacctattacatgccggattacattccacgggacacagacgttttagcggcttttcgc
gtcaccccacagccgggcgttccgatcgaagaagcggcggcagcggtggcagccgaatcc
tcgactggtacctggacgacggtctggactgacaatctcaccgatctagaccgctacaag
gggcgcgcctacgacatcgagccggtacccggcgagagcaaccagttcatctgctacgtg
gcctacccgctcgatctcttcgaagaaggttcgatcaccaacctgctcacttcactggtg
ggcaacgtcttcggcttcaaggcgctcaaggcgctgcgcctcgaagacattcgctttccg
atcgccctggtcaagacctaccccggaccgccccacggcatcgtcgtcgagcgcgacaag
ctcaacaagtacggcagacccctgctcggctgcacaatcaaacccaaactcggcctatcg
gccaaaaactatggccgggcggtctacgagtgcctgcgcggtggcctcgatctgaccaag
gacgacgagaacattaactcgcagccttttatgcgctggcgcgaccgcttcctgttcgtt
caagaggcaatcaacaaagctcaggctgaaaccggtgaaatcaagggccactacctcaac
gtcaccgccggtacctgcgaagacatgatggagcgcgccgagtttgccaaagaaatcggt
tcgcccgtcgtcatgcacgactaccttaccggtggctttaccgccaacaccaccctctcc
aagtggtgccgccgcaacggcatgttgctgcacatccaccgggccatgcacgccgtcatc
gaccgccaaaaaaaccacggcattcatttccgggtgcttgccaagtgcctgcgcctgtcg
ggcggcgatcacatccacaccggtactgtcgtaggcaaactcgaaggcgatcgagcagcg
acgttgggcttcgtcgatctattgcgcgaggatcacatcgagcgcgatctgtcccggggc
atctactttacccaggactacgcctcgatgggcggggtaatggccgtcgcttccggcggt
attcacgtctggcacatgccggccctcgtcgaaattttcggcgacgactcgatactgcag
tttggcggcggtacccttggccacccctggggcaacgctcctggtgccacggccaaccgc
gttgccctcgaagcctgcgtgcaggcgcgcaacgagggacgcaacctgatgcgcgaaggt
ggcgacatcatccgcgaagcagcccgctggagccctgaactggcggcagcttgcgagctg
tggaaggaaatcaagttcgagtacgagacggtcgataccctctag

DBGET integrated database retrieval system