KEGG   Gloeobacter kilaueensis: GKIL_1460Help
Entry
GKIL_1460         CDS       T02885                                 

Definition
glucosylceramidase
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
glj  Gloeobacter kilaueensis
Pathway
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:glj00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    GKIL_1460
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    GKIL_1460
Enzymes [BR:glj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     GKIL_1460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1484787..1487351)
Genome map
AA seq 854 aa AA seqDB search
MGELSRRRFLAGTLLAATFPLARSAQSAPLGVSSTLAALRAGVPRACWSRPIGQPIANVF
KARYPSNIDDGPWHGMPLGGFGAGCIGRSHRGDFTLWHLDSGDHYFRSQPACQFALFEQV
AGAKARAKVLCTEKPADGSLAGWDWSYPKGAGTYAAIYPRSWFTYEGFFTSFVRLKQFSP
IIPHNYKETSYPVALFEWEAFNPSDKPITLSILVSWENMVGWFTNKFKTREIKVRDDDTP
YYDYEPLWGVSGGNFNAARQEDAFLGLTMSRAAGFAGGKVSEAPFVRSEADGQFALATPR
QPGVEVSYHTRFDPTGSGLEVWQPFATTGRLPDLVSVRPAARGERIAAAMALRFTLKPGE
RRLVPVALAWDLPIMEFAPGVRRYRYYTKYFDKTGRNAWKIATEALTRYTDWEQQIEAWQ
TPVLTDSTLPEWYKSALFNELYYLTSGGALWENGFVPARITSIEEIKKAPPGKGYYTVLE
SIDYRWYDSLDVRLYGSFALLMNWPELEKNVLRAYADAVPVEDDSTRIIGYTKKPARRKA
KDALPHDLGAPNEDPWVKTNYTTYQDCNLWKDLPCDFVLLVYRDYVYTGKKDLDFVRYCW
PAARAALVRLKTTFDLDGDGFPENSGAPDSTYDAWPLRGISAYCGGLWLSALLAAIEMGK
LAGDTQSVSQFQSWYAQAQPLYDKKLWNGRYYRIDSQSNNAEAIMSDQLCGEYYAQVCGL
TDIVPTAQAQSALGVIYSTCFEKFYGGKFGCANGTNADGSFIGDTEHPSEIWTGINFGLA
AFMIRNNMKNEGFKIAEAVVRNVYEGGLQFRTPEAITADRTFRACMYLRPTAIWAIQNSL
EATRPGLMQRPALE
NT seq 2565 nt NT seq  +upstreamnt  +downstreamnt
atgggtgaactttctcgccgccgctttcttgcgggcacgctccttgccgccacctttccc
ctcgcacgatcggcccagagcgcacctctgggcgtcagttcgacgctggccgccctgcgc
gccggggtgccccgcgcctgctggtcccgcccgatcggccaacccatcgccaacgtgttc
aaggcccgctacccgagcaacatcgacgacggtccctggcacgggatgcccctgggcggc
tttggggcgggctgcatcgggcggtcgcaccggggagattttaccctctggcacctcgat
agcggcgaccattactttcgctcccaaccagcctgccagttcgccctcttcgagcaggta
gccggggccaaagcgcgcgcgaaggtgctctgtaccgagaaaccggcggacggcagcctc
gccggttgggactggagctatccaaaaggggcgggcacctacgccgctatctatccgcgc
tcctggttcacctacgaaggattttttacgagcttcgtgcggctcaagcagttctcgccc
atcattccccacaactacaaggagacgagctacccggtcgccctcttcgagtgggaggcg
ttcaacccgagcgacaaacccattaccctgagcatcctggtgagctgggagaacatggtg
ggctggttcaccaacaagttcaagacccgtgaaatcaaggtgcgcgacgacgacacgccc
tactacgactacgaaccgctctggggcgtgagcggcggcaatttcaacgccgctcgccag
gaagatgcctttttggggctgacgatgagccgggcagcgggctttgcggggggcaaggtg
agcgaagcgcccttcgtgcgcagcgaggcggacggccagttcgccctcgccaccccccgc
cagcccggcgtggaggtgagctaccacacccgctttgacccgaccggcagcggcctggaa
gtctggcagccctttgccacaaccggtcgcctgccggatctggtgagtgtacggcccgcc
gccaggggcgagcggatcgcagcggcgatggccctgcgctttaccctcaagccgggggag
cggcggctggtgcctgtggccctcgcctgggatctgccgattatggaatttgcccccggc
gtgcgccgctaccgctactacacgaagtacttcgacaagacgggccgcaacgcctggaag
atcgccaccgaagccctgacgcgctacaccgactgggagcagcagatcgaagcctggcag
accccggtgctcaccgattcgacgctgcccgagtggtacaagtcggccctcttcaacgag
ctgtattacctcaccagcggcggcgcgctctgggaaaacggctttgtacccgcccggatc
acttcgatcgaagagatcaaaaaagcgccccccggcaagggctactacaccgttctcgaa
tcgatcgactaccgctggtacgactcgctcgacgtccggctctacggctcgtttgccctg
ctcatgaactggccggaactggagaagaacgtgttgcgcgcctacgccgacgctgtaccc
gtcgaagacgattcgacccgcattatcggctataccaaaaagcccgcccggcgcaaggcc
aaggacgccctgccccacgatctgggagcccccaacgaagatccctgggtcaagaccaac
tacaccacctaccaggactgcaacctctggaaggacctgccctgcgacttcgttctgctc
gtctaccgcgactacgtctacaccggcaaaaaagacctcgactttgtgcgctactgctgg
cccgccgcccgcgccgccctcgtgcgcctgaagacgaccttcgatctcgacggcgacggc
tttcctgaaaattccggcgcgcccgactcgacctacgacgcctggcccctgcggggcatc
agcgcctactgcggcggattgtggctgtcggccctgctggcggcaatcgagatgggcaaa
ctggcgggcgacacccagtcagtcagtcagtttcaaagctggtacgcccaggcccagccc
ctctatgacaagaagctctggaacgggcgctactaccgcatcgacagccagagcaacaac
gccgaggcgatcatgtccgatcagctctgcggcgaatattacgcccaggtctgcggtctt
acggacatcgtgccgaccgcccaggcccagtcggctctgggtgtcatctacagcacctgc
tttgaaaagttctacggcggcaaatttggctgcgccaacggcaccaacgccgacggctcg
tttatcggcgacaccgagcacccgtctgaaatctggacgggcatcaactttggactcgcc
gcttttatgatccgcaacaacatgaaaaacgaaggcttcaagattgctgaggcggtggtg
cgcaacgtctacgagggcggcctccagtttcgcacccccgaggcgatcaccgccgatcgc
accttccgggcctgcatgtacctgagaccgacggcgatctgggccatccagaacagcctc
gaagcgacccggcccggcttgatgcagcgtccggcgcttgaatag

  All links  
No link information was found.   
DBGET integrated database retrieval system