KEGG   Gloeobacter kilaueensis: GKIL_1897Help
Entry
GKIL_1897         CDS       T02885                                 

Gene name
glsA
Definition
(GenBank) glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
glj  Gloeobacter kilaueensis
Pathway
glj00220  Arginine biosynthesis
glj00250  Alanine, aspartate and glutamate metabolism
glj00471  D-Glutamine and D-glutamate metabolism
glj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:glj00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    GKIL_1897 (glsA)
   00220 Arginine biosynthesis
    GKIL_1897 (glsA)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    GKIL_1897 (glsA)
Enzymes [BR:glj01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     GKIL_1897 (glsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: AGY58143
UniProt: U5QGX3
Position
complement(1997678..1998718)
Genome map
AA seq 346 aa AA seqDB search
MGSSAIPVEQESGSQFLAYLQQLHRTYSSLQEGVVASYIPEIARADPDWFAICAVTVDGR
LFQVGDDEQLFTIQSISKPFVYGLALEDHGRDYVLTRVGVEPTGDPFNSIIKLDESSKRP
LNPMVNAGAIATASLIKGSDPTERLNRMLAMFRRYVGHDVFVDMSVFVSERTTGHRNRAM
AYLMLNFGMIDAHVEQVLDLYFQQCSVMVNCRDLALMAATLANNGVNPHTKERALEEHYV
RDLLSVMYTCGMYDYSGEWAYNVGLPAKSGITGGIIAVVPGVMGIAVFSPRLQSQGNSLR
GIRVCQDLSEHFGLHVFSMDTAGSALLKRLLQVPSAGNSLPGSTSE
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgggctcctctgctattccagtcgaacaagaaagtggctcccagtttctggcctacctg
cagcagttgcaccgcacctacagctctctgcaggaaggggtggtagcgagctatatccct
gagattgcccgagcggacccggactggtttgccatctgtgcggttactgtcgatgggcgg
ctgtttcaggtaggggacgacgaacaactttttacgatccagtccatctccaagcccttc
gtctacgggctagcgctggaagaccacggtcgcgactacgtgctcacccgcgtcggggtg
gaaccgaccggcgatccgttcaactcgattatcaagctggacgagtcctcgaagcggccc
ctcaacccgatggtcaatgccggggcaatcgccacggccagcctgatcaaaggctccgat
ccgaccgaacgtctcaaccggatgctcgccatgttccggcgctacgtcggtcacgatgtc
ttcgtcgatatgtccgtctttgtgtccgagcgaactaccggtcaccgcaaccgggcaatg
gcctacctgatgctcaacttcgggatgatcgacgcccacgtcgagcaggtgctcgatcta
tactttcagcagtgttcggtgatggtcaactgccgcgacctggcgttgatggccgctacc
ctcgccaacaacggcgtcaacccccatacaaaagagcgcgccctcgaagagcactacgtc
cgcgacctgctctcggtgatgtacacctgcgggatgtacgattactcgggcgagtgggcc
tacaacgtcggtctacctgccaaaagcgggattaccggcggtatcatcgccgtcgtgccg
ggagtaatgggcatcgccgtcttctcgccccgactgcagtcccagggcaacagcctgcgg
ggcatccgcgtctgccaggatctctccgagcacttcggcctgcacgtcttcagcatggac
acggctggttctgctctgctcaagcgcctgctgcaggtgccgagcgcggggaacagcctg
cctggctcgacctctgagtaa

DBGET integrated database retrieval system