KEGG   Gloeobacter kilaueensis: GKIL_2495Help
Entry
GKIL_2495         CDS       T02885                                 

Gene name
rbsK
Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
glj  Gloeobacter kilaueensis
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:glj00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    GKIL_2495 (rbsK)
Enzymes [BR:glj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     GKIL_2495 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2639388..2640308
Genome map
AA seq 306 aa AA seqDB search
MSTAGPRVVVAGSINMDIVLSAHRHPLPGETISGQRVQFFAGGKGANQAIAAHRLGAAAQ
LVGRIGDDLFGRDLRNFLVGEGLAFDQIYPSKGASGTALIVVVPTGENTIVVVPGANGQL
SAADVEVEIHPDDVLISQLEIPIATVTHFFGRGRSVGARTLLNAAPAQLLPAELLLLIDI
LIVNETELAILSGRTVQPDSPQSVAAAAQLLQRAIETVVVTLGAHGAVACRGTDLLVVPG
RRVQAIDATGAGDCFVGALAARLAAGEALEQALGFANVAASLCVERPGAAGAMPTLGQVQ
AVLQIK
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgagcacagcaggcccacgggtggttgtcgccggtagcatcaacatggatatcgtcctc
tcggcccatcgtcatccgctgcccggcgagacgataagcggccagagagtccagtttttt
gccggcggcaagggagccaaccaggcgattgctgcccaccgcctgggagcagcagcgcag
ctggtaggccggataggcgacgatctatttggccgggatctgcgcaattttctggtgggc
gaggggctggcgttcgatcagatttatccgagcaaaggggcgagcggcacggcgctcatc
gtcgtcgtcccgacgggcgagaatacgatcgtcgtcgtccctggtgccaacgggcagctc
agcgctgccgatgtcgaggtcgaaatccaccccgacgacgtgctgataagccagctggaa
attccgattgcaaccgtcacccacttttttgggcggggccgctccgtgggagcccgcacc
ctgctcaacgccgccccggctcagctgctacccgctgaactgttgctgctcatcgatata
ttgatcgtcaacgagacggaactcgcgatcttgagcggtaggaccgttcaacccgatagt
ccccagagcgtcgctgccgccgcccaactgttgcaacgggcgatcgagaccgtcgtcgtc
accctgggagcccatggggcggtggcctgcaggggtacggatctgctggtcgtgccgggc
cggcgtgtccaggccatcgatgcgaccggggcgggcgattgctttgtcggtgctctggct
gccaggctggcagcgggcgaagcgctggagcaggcgctgggctttgccaatgttgccgcc
tcactctgcgtcgagcgtccgggggcggctggggcgatgccgactctggggcaggtgcag
gccgtacttcagataaagtag

DBGET integrated database retrieval system