KEGG   Gloeobacter kilaueensis: GKIL_2533Help
Entry
GKIL_2533         CDS       T02885                                 

Definition
stearoyl-CoA 9-desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
glj  Gloeobacter kilaueensis
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:glj00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    GKIL_2533
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    GKIL_2533
Enzymes [BR:glj01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     GKIL_2533
Lipid biosynthesis proteins [BR:glj01004]
 Desaturase
  First
   GKIL_2533
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2681781..2682635
Genome map
AA seq 284 aa AA seqDB search
MKTHSSALSGLASLKWPLVGFIGTVHLLALLAPWCFSWSALGVALLLHWLLGGIGICLGY
HRLLAHRSFRLPQLLERAVALLGALALQGGPIFWVAGHRRHHAWTEDPTRDPHASTRGFW
WSHLLWLVQPQAQPPAEKFAADLACQPFYRWLERYHLLLQLPFGLLLFLLGGVPFVVYGI
FVRTVLLWHTTWLVNSAAHLSGYRSYQTADCSRNLWWVALLTYGEGWHNNHHAHPRAARA
GLLWWEVDLTWGTIRLLEMVGLARKVVRPSCLVNCESVTSKVRG
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacccattcttctgctttgagcggcctggcgtcgctcaagtggccgctcgtcggt
tttattggcaccgttcatcttctggccttgctggctccctggtgttttagctggtccgcc
ctcggggttgcgctgctgctgcactggttgttgggcggtatcggcatctgcctgggctac
caccggctgctggctcaccgcagcttccggctgccgcagcttctggagcgggcggttgcc
ctcctcggcgcgctggctctgcagggcggcccgatcttctgggtagcggggcaccggcgg
caccacgcctggacggaagatccgactcgcgatccacacgcttccacgcgcggcttctgg
tggagccatctgctctggctggtccagccccaggcccagccaccggcagaaaagttcgct
gcggatctggcctgtcaaccgttctacaggtggctggagcgctatcatctgttgctgcaa
ttgcccttcgggttgctgttgtttctattgggcggcgttcccttcgtcgtctacggcatc
tttgtgcgcacggttttgctctggcacaccacctggctcgtcaactccgccgcccatctg
agcggttatcgctcctaccagaccgccgactgctcgcgcaacctctggtgggtggccctg
ctcacctacggcgagggctggcacaacaaccaccatgcccatccgcgcgccgctcgggcc
ggtctgctgtggtgggaggtcgatctcacctggggaacgatccggctcctggagatggtg
gggctggcccgcaaggtggttcgaccatcctgccttgtcaactgtgagtccgttaccagc
aaagttcgaggatag

DBGET integrated database retrieval system