KEGG   Gloeobacter kilaueensis: GKIL_3674Help
Entry
GKIL_3674         CDS       T02885                                 

Gene name
puuE
Definition
4-aminobutyrate aminotransferase (EC:2.6.1.19)
Orthology
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
glj  Gloeobacter kilaueensis
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:glj00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    GKIL_3674 (puuE)
   00650 Butanoate metabolism
    GKIL_3674 (puuE)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    GKIL_3674 (puuE)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    GKIL_3674 (puuE)
Enzymes [BR:glj01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     GKIL_3674 (puuE)
Amino acid related enzymes [BR:glj01007]
 Aminotransferase (transaminase)
  Class III
   GKIL_3674 (puuE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3881635..3882954)
Genome map
AA seq 439 aa AA seqDB search
MLSLSTDRSLPRVPRLTTALPGPRARTVIERDRAVTSPSYTRGYPLVAARGEGCMLEDVD
GNVFLDLTAGIAVTATGHAHPQVVQAIQEQAARLLHMSGTDFYYEPMADLAESLAARAPF
PVVAGAPRARVFFSNSGAESNEGALKLARYYTGRQQVVAFLGAFHGRTFGAMSLTGSKAV
QRKGFGPLVPGISHIPYGTHAALDHLEQRLFATVLPPEEVAAIVVEPIQGEGGYIVPEDG
FHARIRQICDRHGILMVVDEVQAGMGRTGRLFAIEHWGVEPDIITLAKGIASGLPLGAIL
ARPHLMSWPPGSHATTFGGNPVACAAANATLVLLEAGLIENAQRMGSLLQAGLAELAVRF
ARISPPRGKGLMVAVDLLDKNGQPDRELRDHLVDCAFYKGLLLLGCGKAAIRFCPPLVID
ADQIRTALDLLRQLAEEVF
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgctcagtctgtctaccgaccgttccctgccccgtgtgcccagactcaccacggcgctg
cctggcccccgcgctcggacggtgatcgagcgcgacagggctgttacctcgccctcctac
acccgtggctacccgctggtggccgcccgtggcgagggctgtatgctcgaagatgtcgat
ggcaatgtctttttagacctgacagccggtatcgccgtcaccgccaccggccacgcccac
ccgcaggtggtgcaggcaatccaggagcaggcggcccgactgctccatatgtcgggaacg
gacttttattatgaaccgatggcggatctggccgagagcctggcagcgcgcgcgccgttt
ccagtggtggccggtgctccccgcgcccgcgtcttttttagcaactctggagcggagtcc
aacgaaggagcgctcaagctggcccgctactacaccggtcggcagcaggtggtcgccttt
ttgggtgcctttcatggccgtacctttggggcgatgtcgctgaccggctccaaggctgtt
cagcgcaaaggttttggcccgctggtgccggggatcagccatataccctacggcacccac
gccgccctcgaccacctcgaacagcgcctgtttgcgacggtgctgcccccggaggaggtg
gcggcgatcgtcgtcgaaccgattcagggcgaaggcggctatatcgtgccggaggacggc
ttccacgcccgcatccgtcagatctgcgatcgccacggcatcttgatggtggtcgatgaa
gtgcaggccggtatgggccgcaccggtcgcctgtttgccatcgagcactggggcgtcgaa
cctgacatcattaccctcgccaaggggatcgcgagcggtctgcctctgggggcgattctt
gcccgaccgcacctgatgagctggccgcccggttctcacgccaccaccttcggcggtaac
ccggtggcctgtgcggctgccaacgctaccctcgttctgctcgaagcggggctcatcgag
aatgcccagcgcatgggcagcctgttgcaggcgggactcgccgaactggcggtgcgcttt
gcccgcatttcgcccccgcgcggcaaaggtctgatggtcgccgtcgatctgctcgataag
aacggtcaacccgaccgcgagctgcgcgatcacctcgtcgattgcgccttttataagggg
ctgttgcttctgggctgcggcaaggcggcgattcgcttctgcccgcctctggtcatcgat
gccgaccagatccgcactgccctcgacctgttgcgccagctggccgaggaggttttctga

DBGET integrated database retrieval system