KEGG   Gloeobacter kilaueensis: GKIL_4256Help
Entry
GKIL_4256         CDS       T02885                                 

Gene name
malS
Definition
malto-oligosyltrehalose trehalohydrolase (EC:3.2.1.141)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
glj  Gloeobacter kilaueensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:glj00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    GKIL_4256 (malS)
Enzymes [BR:glj01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     GKIL_4256 (malS)
Exosome [BR:glj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GKIL_4256 (malS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4479024..4480745
Genome map
AA seq 573 aa AA seqDB search
MVTEKKLSKPSESESKPLAGSPKKRKTAKLRFQLLAPYNEKASLVGSFSNWEPIEMKRGK
KGFFYIDVALPDGEYEYKFQTVSKSFFAEGQTVTFADPYARQVDEKNRENGIIRIKNGER
ITDEYTWKHDDVPLTADDRLIIYEMHVSAFGGNGYQEAIGRLDYLVDLGVNCVQLMPVTE
YPGEHYWGYNPRYAFAPESSYGKPEDLKAFIDACHARGIRVILDIVLNHSESESPLTRID
FTYWFYQPGTEPDEPGNVWGPKYNLEFYDKKFKRNPAREFLYELVEYWVREYHIDGYRID
AARQIKYFDFLAEVARRSKETAGVKPFYIVAEHIPENPAITGADGPADGAYHETYYWMID
DLMVRNMFSTDQIIDSINPLHHGYPGPSNAVNFYENHDKPRLLQRLRDAGINEEGSFKRL
ECAAALLMTSVGLPMLYQGQAMAQAYPQDEQVHPVEWELLEQQRHQALHERYKGLIALRR
ENHALWTNHIDFFHIDEEARVLAYVRYNDEGARVAVVAHLGDGFLGNYQVPCFPVDGHWH
EWTRNYAVEVDGGILNVELSDWDVHVFRFEGQG
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atggtcactgaaaagaaactttctaaaccgtccgaatcagagagcaagcctcttgcaggt
tcacccaaaaaacgcaagacagccaagctccgctttcaactgctcgctccttacaacgaa
aaagcgagcttggtcggctcattttctaactgggaaccgatcgagatgaagcggggcaag
aaaggctttttctacatcgatgtggcccttcctgacggcgaatacgaatacaagttccag
acagtatccaagagtttcttcgccgaaggccagacggtgacctttgcggacccctacgcc
cgccaggtggacgaaaagaaccgcgagaacggcatcatccgtatcaaaaatggcgagcgg
atcaccgacgaatacacctggaagcacgacgatgtgcccctgacagcggacgaccggttg
attatctacgagatgcacgtcagcgcctttggcggcaacggctaccaggaggcgattggc
aggctcgattatctggtcgatctgggcgtcaactgcgtacagctgatgccggtcaccgag
tatccgggcgagcactactggggctacaatccgcgctatgcctttgctcccgagtcctcc
tacggcaaaccggaagatctcaaggcgtttatcgacgcgtgccacgctcgcggcatccgg
gtaattctcgacatcgtcctcaaccactccgaatcggagagcccccttacccgcatcgac
tttacctactggttctaccagcccggcaccgagccggacgagccgggcaacgtctgggga
ccgaagtacaacctcgaattttacgacaaaaagttcaagcgcaacccggcccgcgaattt
ctctacgaactggtcgaatactgggtgcgggagtaccacatcgacggctaccgcatcgac
gcggcccggcagatcaagtacttcgactttttagccgaagtggcgcggcgctccaaagaa
accgccggggtcaagccgttttatatcgtcgccgagcacatccccgaaaacccggcgatt
accggcgcggacggcccggcggacggtgcctaccacgagacctactactggatgatcgac
gatctgatggtgcggaacatgttcagcaccgaccagatcatcgactcgatcaaccccctg
caccacggctatccgggaccgagcaacgccgtcaacttttacgaaaaccacgacaagccg
cgcctgttacagcggttgcgcgacgctgggatcaacgaagaaggcagcttcaagcgcctc
gaatgtgcggcggcgctgctgatgacctcggtgggcctcccgatgctctaccagggccag
gcgatggcccaggcgtatccccaggacgagcaggtccacccggtcgagtgggagctgctg
gagcagcagcgccaccaggctctgcacgagcgctacaagggcctcatcgccctgcggcgc
gaaaaccacgccctctggaccaaccacatcgactttttccacatcgacgaagaagcgcgg
gtgctcgcctacgtgcgctacaacgacgagggggcgcgggtggcagtcgtcgcccacctc
ggagacggcttcctcggcaactaccaggtgccctgctttccggtggatggccactggcac
gagtggacgcgcaactacgctgtcgaggtcgatggcggcatcctcaacgtcgagctgagc
gactgggacgtgcatgtcttccgcttcgagggccagggctag

DBGET integrated database retrieval system