KEGG   Gloeobacter kilaueensis: GKIL_4397Help
Entry
GKIL_4397         CDS       T02885                                 

Definition
glycosyl transferase group 1 (EC:2.4.1.198)
Orthology
K16150  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
glj  Gloeobacter kilaueensis
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:glj00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    GKIL_4397
Enzymes [BR:glj01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     GKIL_4397
Glycosyltransferases [BR:glj01003]
 Polysaccharide
  Storage polysaccharide
   GKIL_4397
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4618007..4619143
Genome map
AA seq 378 aa AA seqDB search
MLHIAAEFPPITWGGMGTAVGGLCRASARAGMTAAVLLVGGILVLPEEAGPFSNEEGWLN
ADGVRLFQIAPSDGPQRTIDLVRRWQPDLLHLHTAWLWDTIRPVLEVTGLPFVFTVHSLD
RAEYEIGRLVSAWENQAQVLVAANRIVVPSKSEAALLVRYYPEVGSRVRVAANGIDERPI
AVRERRGEPPTVLFSGRFVERKGIGELLAAIPEVLSVRPTTRFVLAGGYGGPAEVDFMGL
QQQMAPYRQQVHFTGWLAAEEMDAWYRRSDILVVPSWYEPFGMVVLEGMLHGLAVAATAV
GGPAEILDHGRTGWLFASRNVDALKAALIQLVDSAELCLQLGAAAQEAVRRHWLWPQVLQ
KLTCVYREAIGCRDSYEI
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
gtgctgcacatcgccgctgaatttccgcccattacctggggcggcatgggaacggcggtg
ggtgggctgtgcagagcctccgcccgcgccgggatgacggcagcggtgttgctggtggga
gggattctcgtgttgcccgaggaagccgggccgttctcgaacgaggaaggctggctcaac
gccgacggcgtgcgactttttcagatcgccccctccgacgggccgcaaaggactatcgat
ctggtgcgccgctggcaaccggatcttctgcacctgcacacggcctggctctgggacacc
atccggcctgtgctggaggtgacaggtctgccctttgtctttaccgtccactcgctcgat
cgggccgagtacgagattggccggctggtgagcgcttgggaaaaccaggcccaggttctc
gtcgccgcaaaccggatcgtcgtgccttctaagagtgaagcagcgctgctggtgcgctac
taccccgaggtgggctcccgcgtccgcgtcgccgctaacggcatcgacgagcggcccatc
gccgtgcgagagcggcgcggcgagccaccgaccgtgctcttcagcgggcgcttcgtcgag
cgcaagggcatcggcgagttgctcgccgccatccccgaggtgctctcggtgcggcccacc
acccgcttcgtgctcgcaggcggctacggcggcccggcggaggtagattttatgggtctg
cagcaacagatggccccctacagacagcaggtccacttcaccggctggctcgccgccgaa
gagatggacgcttggtaccgccgctccgacattctggtagtgcccagctggtacgaaccc
tttggcatggtagtgctcgaagggatgttgcacggactcgccgtcgcagccaccgccgtc
ggcggtcccgccgagattctcgatcatggccgaaccggctggctgtttgcctccaggaat
gtcgatgccttaaaagcagcgctgatccagcttgtagacagcgccgaactgtgcctgcag
ctgggagccgccgctcaagaggcggtgcgccgccactggctctggccccaggttcttcaa
aaactcacctgcgtctaccgtgaggcgattggctgtcgagacagttacgaaatttag

DBGET integrated database retrieval system