KEGG   Geobacter lovleyi: Glov_0244Help
Entry
Glov_0244         CDS       T00708                                 

Definition
helicase, RecD/TraA family (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
glo  Geobacter lovleyi
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:glo00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Glov_0244
Enzymes [BR:glo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Glov_0244
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
222020..224206
Genome map
AA seq 728 aa AA seqDB search
MNGKGTTSDVPVERISGSVERVTFHSEESGFCVLRIKVKGKRELVTVIGSAATITPGEFV
ECVGTWHNDKTHGLQFKTTHLKTVPPSTLEGIEKYLGSGMVKGIGPHFAKVLVKAFGVDV
FTVIEETPEKMLSLPGIGKKRTDKVTAAWAEQKAIREIMVFLQSHGVGTGRAVRIYKTYG
DEAIIKVSENPYRLALDIHGIGFKTADVIADRLGIAPDSLIRAQAGVRHVLQELSGDGHC
AATHDTLIKESVKLLEIDEAILEEAIREEVTQENLVPEEIDDVPCLFLSALHRAELGVAN
SVRRILSGEPPWGKIDMEKALPWVEEKTGLSLSQSQQDAVCLALTSKALVITGGPGTGKT
TLVNSILKILAAKQLEILLAAPTGRAAKRMTETTGREAKTIHRLLEFDPQSFGFKRGRDN
PLEADLIVIDESSMVDVVLMNKLLAAVPESTALMIVGDVNQLPSVGPGAVLADIITSGSV
PTVRLTEIFRQAATSKIIVNAHRINKGELPLRNETEELSDFYFIPAETPEEIHAKLLQVV
TERIPKRFGLHPVKDVQVLTPMNRGGLGAHALNAELQKVLNGNSEPKITRFGTTYSPGDK
IIQTVNNYDKEVFNGDIGQILEIDTEESSLKADYDGRIVEYEFGELDEVSLAYATSIHKS
QGSEYPAVVIPLAMQHYMLLERNLIYTAVTRGKKLVTIIGQPKALGMAVKNKNATKRLTN
LTARLRSA
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgaacgggaaaggcaccacttcagatgtcccggtcgaacggatttccggttccgtcgag
agggtaaccttccacagcgaggaatcaggtttctgtgtgctccggatcaaggtaaaaggt
aagcgcgagttggtcacggtcatcggcagtgcggcaacgataaccccaggtgaattcgtc
gagtgtgttggtacctggcataacgacaagacccacggcctgcagttcaagactactcac
ctgaaaacagtccccccgagtaccctggaaggcatcgaaaagtaccttggctccggcatg
gtcaaagggatcggcccccatttcgccaaagtactggtgaaggcattcggcgtcgacgtc
ttcaccgttatcgaggaaaccccggagaaaatgctgtcactccccggcattggcaagaaa
aggacggataaagttaccgctgcctgggcagagcagaaagcgatccgggagatcatggtt
ttcctccagtcccatggtgtcgggaccggtcgggcggtcaggatctacaaaacttatggc
gatgaggccatcatcaaggtgtctgagaacccctaccgcttggctctcgacattcacgga
atcggtttcaagaccgctgacgtcattgccgacaggctgggtattgccccggactcactg
atccgggctcaggccggcgtgcgccatgtattgcaggagttgtccggcgacggccattgt
gccgccacccacgacaccctcatcaaggagtcggtaaagcttctggagattgacgaggca
atcctggaagaagcgatccgggaggaagtcacccaggaaaacctggtgccggaagaaatc
gacgacgttccctgtctgtttctgtccgcgcttcaccgggctgaactgggagtggcgaac
agcgtcaggagaatactgagtggagagccgccatggggcaaaatcgatatggaaaaggcg
ctcccctgggtggaagagaagacgggcctttcactctcccagtcgcagcaggacgctgta
tgccttgctttaaccagcaaagcactcgtcatcaccggcggcccgggcaccggcaagacg
accctggtcaatagcatcctgaagatcctcgcagccaaacagctcgaaatcctgttggcc
gccccgaccggacgcgcggccaagcggatgaccgagactacaggacgggaggccaagacc
attcatcgcctcctggagtttgatccccagagtttcggtttcaaacgcgggcgagacaac
cctctcgaagcagacctcatagtcattgacgaatcatctatggtggatgtggtgctgatg
aacaagctcctcgcggcagtccccgaaagcaccgctctgatgattgttggcgatgtaaat
cagctgccttcagtcggtcccggtgcggtgctggccgacatcatcacatccggttctgtc
ccgaccgtcaggctgaccgagattttccgccaggcagccacctcaaagatcatcgtcaat
gcccaccggatcaacaagggagagttgccgctgagaaatgaaacggaagagctatccgac
ttctacttcataccggcagaaactccggaagaaattcacgccaagctactgcaggtggtt
accgaacgcattccgaagcgcttcggcctgcatccggtcaaggatgtccaggttctcacc
ccgatgaaccggggaggactgggcgctcacgccttgaacgcggaactccagaaagtgctc
aatgggaacagcgagcccaaaataacccgctttggaacgacgtactcgccgggtgacaag
atcatccagacggtgaataactacgacaaggaagtcttcaacggggatattggccagatt
cttgaaatcgataccgaggaaagctccctcaaagctgattacgacggtagaatagtcgag
tatgaatttggtgaactggacgaggtgtcgctggcctatgccaccagcatccataagagc
cagggttcagagtacccagctgtcgtgattccactggcaatgcagcattacatgctgctg
gagaggaatctgatctatacggccgtcacgcgggggaaaaaactggtgacgatcatcggc
cagcccaaggcattgggtatggcggtgaagaataaaaatgccacaaagcgtttgacgaat
ttgacagcgaggctgcgttccgcatga

  All links  
No link information was found.   
DBGET integrated database retrieval system