KEGG   Geobacter lovleyi: Glov_0323Help
Entry
Glov_0323         CDS       T00708                                 

Definition
protein-disulfide isomerase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
glo  Geobacter lovleyi
Brite
Enzymes [BR:glo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Glov_0323
Secretion system [BR:glo02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Glov_0323
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(297880..298632)
Genome map
AA seq 250 aa AA seqDB search
MKTANNKKLMVGGLMMFIVTAAGFSMANDNLRTEKETLMKTFPNMKLDGFRESPLKGLYE
ITAGEQVFYFSPEGYLFFGEIWTKDGKNLTAEMREKVVAERINSLPLDKALKIGNGPKKV
IEFTDPDCPYCRKVDNFLSKRTDVTRYVYFVPLRRIHPDAEKKARYILSQSDRDKAFHEV
FEGVLDGKPISIVDGAQQQQLEEMEKIAAGLGVRGTPALWIEGAHVNGADIQRITGLLDK
GKEVSKPQTH
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaccgcaaataacaagaaacttatggtcggcgggctgatgatgttcatcgtgact
gcggcgggtttctctatggctaacgacaatctgagaacggagaaagagaccctgatgaag
acctttccaaatatgaaattggatggcttcagggaatcgccgctcaagggcctatatgag
atcaccgcaggcgaacaggtattttacttcagccccgagggatacctattttttggtgaa
atctggaccaaagacggcaaaaacctgacagccgagatgcgggagaaggttgttgcagaa
cgaatcaacagtctcccccttgataaagccctgaaaataggcaacggcccgaaaaaggtc
atcgagttcaccgaccctgactgcccctattgccgcaaagttgacaacttcctctcgaag
cgaactgacgtgacccgttacgtctatttcgtcccgctacgcaggatacatcccgacgca
gagaaaaaggcccgctacattctgtcgcaatctgacagggacaaggcattccatgaggta
ttcgagggagtgctggacgggaaacctatctccatagtcgatggcgcacagcaacagcaa
ctggaggagatggagaagattgcggctgggcttggcgtacgaggaacaccggcactctgg
atcgaaggtgctcacgtgaatggtgcagacatccaacggataaccggattgctggacaag
ggaaaggaggtgagcaagccgcaaacacactga

DBGET integrated database retrieval system