KEGG   Geobacter lovleyi: Glov_0501Help
Entry
Glov_0501         CDS       T00708                                 

Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
glo  Geobacter lovleyi
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:glo00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(476820..477650)
Genome map
AA seq 276 aa AA seqDB search
MSTSGKLPTSPLRGCRILVTRAAEQAAGFSRQLQQRGAVVVECPTIQLVPPEAWTAVDAA
IQALSGFDWLILTSANGVRFFFGRLQELGLAPAGLQSCKVCAVGPKTAEALTQLGITPDL
IPEQFTGEGVVAAFHGHDLQGRRVLFPKADGARDLIPQQLRSRGAVVIDPVLYRNIIPQG
LPDSARLALEQHQLDAVVFSSPSTVRNLAQLTGGITRLQALLADLAVVSIGPVTTRACQE
LGLSVAVEPEQSTLDALIRALEQHTLCCPSATPPIT
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgtctaccagcgggaaattgcccactagccccctacggggctgccggattctggtgacc
cgcgcggcagagcaggctgccgggttctcccggcagttacaacagcgtggcgctgtggtg
gtggaatgccctaccattcagctggtgccacctgaagcctggaccgctgtggatgctgcc
atccaggctttatccggctttgactggctgatcctgacctcggcaaacggggtcaggttt
ttctttggccggttacaggaactggggcttgcccccgctggactgcagagctgtaaggtc
tgcgcggtcgggcctaagaccgcagaggccctgacgcagctgggtatcacacctgatctt
atcccggaacagttcaccggagaaggagtggtggccgcgtttcacggacatgacctgcag
gggcggcgggtactgtttcccaaggcagatggtgcccgcgacctgattccgcagcaactg
cgcagtaggggggccgtggtgattgacccggtgctctaccgcaacatcatcccgcagggt
ttgcctgactctgcccgtctggccctggaacagcaccagcttgatgcggttgtcttcagt
tccccttcaaccgttcgcaacctggcacagttgacgggcggcatcacccggctgcaggca
ttgctggcagatctggctgtggtctccatcgggccggtaacaaccagggcctgtcaggag
ctggggcttagcgttgccgtggaaccggaacagtcaaccctggatgccctgattcgtgcc
cttgagcagcataccctctgctgcccctccgctacgcctcccatcacctaa

DBGET integrated database retrieval system