KEGG   Geobacter lovleyi: Glov_0566Help
Entry
Glov_0566         CDS       T00708                                 

Definition
chemotaxis protein CheR (EC:2.1.1.80 2.7.13.3)
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
glo  Geobacter lovleyi
Pathway
Two-component system
Bacterial chemotaxis
Module
CheA-CheYBV (chemotaxis) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:glo00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Glov_0566
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Glov_0566
Enzymes [BR:glo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     Glov_0566
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Glov_0566
Two-component system [BR:glo02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Glov_0566
Bacterial motility proteins [BR:glo02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Glov_0566
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
543591..547172
Genome map
AA seq 1193 aa AA seqDB search
MSEQATQLPPEEDLPESAAEDADNTDWQPITDLLRRGLGIDFGCYRAGTVGRRIMRRMEL
LQLDDVADYATLLAASQEELEALGRDLLIGVTEFFRDPAVFRRLADLLRELLRGRSATEG
FRIWSAGCASGEEAYSLAVLLHDVAQEVGFSGDLKVFATDVHKGALEIASRGGYCGELLA
GLPGQYLDRYFRSESDGCFRIDPMIRRMLVFAHHNLLSDPPFTRIDLAVCRNLLIYLQAE
AQQRVLTALQFSLVPGGHLLLGPSEGVSHLANAFSVLDSGCKLFRKNATPRDGIVAPGIP
WVARNPLLASLNQGTRTTVTLDRHLLRDYDLILDRYAPPGMLLNSQRQVLHIFGDLSEYL
RPLTGRLTGDMFSNLRDELRPALSTALLRAEQHGEATVVDRVPLLQEESCRYVDVAVACL
TDERSDGLHFHVTLRPSDWQPEAGDCSNSNHHEVDSALHRRVADMEQELHSTRHSLQLTI
EELQSSNEKLDLANEELISSNEELQSTNEELKSVNEDLYAVNSELEHRNEELQRLNRDHD
NLLASTEVGTVFLDQQLRIRKFSSAISAFLKLLPQDLGRPIDHIAYELGSPQEFRERLQQ
VLESGLRHEQEIHTGADQWVLQRILPFRTDNGSIDGVVLTFTDISAVKQAQAAVAEMNIQ
LEQKVIERTCELSASEARIRAFIENSGQGFWQLGPDRLTIDLNPALCSMLGYRREEMLGR
SPLEFVDAENRSIFLYQMGRIDGTEHRNYEITLLHKDGHPVPVMFSATTHRTVEGKVDSA
FAFITDLSEQKRVEQEIRAAKEAAESANRAKTQFLANISHEVRTPLNGIMGMSHLLHMTP
LADEQQDYLRHLDDSAQSLLSVINDLLDLTRIESGGFGTEQADFQLDQLARDILRIHQPV
AQRKGVLLQLELADGMPGLLRGVPLRLKQVLHNLVGNAVKFTDQGRVVLSISPIIVPGQS
LRVRFAVCDSGIGMEPETIKRIFDPFSQADESISRRYGGTGLGLTICRRLTELMGGTIEV
ESTPGQGSCFTVILPMKTPLGAVVPADAPVRQDSFERNALQVLLAEDQPVGRLYATRLLE
RLGHRVTAVEDGKQAIEAWEQNCFDLILMDVQMPGIDGTMATASIRQREQEGGVRTPIIA
LTAHALTGDRSKLMECGFDGYVPKPIDVEGLLAEVNRLITPATVLCSRRGEQP
NT seq 3582 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaacaggctacacaactgccgccggaagaggatctgccggagtccgcggccgaa
gatgcggacaacaccgattggcagccgattaccgacctgctgcggcgcgggctgggaatt
gacttcggctgttaccgggccggcaccgttggacgcaggatcatgcgccggatggagcta
ttgcagcttgacgacgttgctgattacgccactttgctggctgccagccaggaggagctg
gaggcgctgggccgtgatctgctgatcggcgtgaccgagtttttccgcgaccctgccgtg
ttccgccgcctggccgatctgttgcgcgagctgttgcggggccgttcggccacggaagga
ttcaggatctggtcagccggttgcgccagcggggaggaagcctattctttggcggtactg
ctgcatgacgtggcgcaggaggtgggatttagcggcgacctgaaggtgtttgccaccgac
gttcataagggggcgttggagatagcctcccgggggggctactgcggcgaactgcttgcc
ggtctgcccggtcagtaccttgaccggtacttccgctctgaaagcgacggctgtttcagg
attgatccgatgatccgccgcatgctggtgtttgcccatcacaacctgctctctgatccg
ccgtttacccggattgaccttgccgtctgccgcaacctgctgatctacctgcaggccgag
gcacaacagcgggtactgacggccctgcaattctctctggtgccgggcggccatctgctg
ctgggaccgagcgaaggggtcagccatctggccaatgccttcagcgtactggattcaggc
tgcaagttgtttcgtaaaaatgcgaccccccgggacggcattgttgcgccaggtatcccc
tgggtcgcccgtaatccgctgctcgcctcacttaaccagggaacccgcactaccgttacc
cttgaccggcacctgctgcgtgactacgacctgatcctggatcgttacgccccgccaggc
atgctgctgaacagccagcgccaggtgctgcatatctttggtgatctgagtgaatacctg
cggcccctgaccgggcggctgaccggcgacatgttcagcaatctgcgggatgaactgcgt
ccggccctttccaccgccctgctgcgggcagaacagcatggtgaggcaacggtggtggac
cgggtgcctctgctgcaggaggaatcctgccggtacgtcgatgtcgcggtggcttgtctg
acggacgagcgcagcgacggcctgcattttcatgtcaccctgcgcccgtccgactggcag
ccggaagccggagactgcagcaacagtaatcaccatgaggtcgactcggccttgcatcgc
cgggtggccgatatggaacaggagctgcactccacccgtcactcattgcagctgaccatt
gaagagctgcagtccagtaacgaaaagctggatctggccaatgaggagctgatttcatca
aacgaagaactgcaaagcaccaatgaggagctgaagtcggttaacgaagatctctacgcc
gttaacagcgagcttgaacatcgcaatgaagagctgcagcggttaaaccgtgaccatgac
aacctgctggccagtaccgaggtggggacggtctttctcgatcagcaattacggatccgc
aagttttcaagtgccatcagcgcctttctcaagctgctgccccaggatctggggcggccg
attgatcatatcgcctatgaactgggttcgccccaggagttccgtgaacggctgcagcag
gtgctggagagtggtctgcgccatgaacaggagatccataccggagccgaccagtgggtt
ctgcagcggatactcccgtttcgtaccgacaacggcagcattgatggcgtggtgttgacc
ttcacggatatcagtgcggtcaagcaggcccaggccgctgtggcagagatgaacattcag
ctggagcagaaggtgatcgaacggacctgcgagctgtctgcaagtgaggcccggattcgt
gccttcatcgaaaattcaggtcagggtttctggcagctggggcctgaccggttgaccatc
gatctgaatccggccctttgctccatgctgggctaccgccgggaagagatgctgggccgc
tctccgcttgagtttgtggatgccgagaaccgctcgatcttcctgtatcagatggggcga
atcgacggaaccgaacatcgcaactatgaaataacgctgctgcataaggatgggcatccg
gtgccggtcatgttttctgccactacccatcgcaccgtcgagggcaaggtggatagtgcc
tttgcctttattaccgatctgagcgaacagaagcgggtagaacaggaaatccgggccgcc
aaagaggctgccgaatcggccaaccgggccaagacccagtttctggccaacatcagtcat
gaggtccgcactccgctgaacgggatcatggggatgagtcatctgctgcatatgaccccg
ctggccgacgaacagcaggactacctgcgccatctggatgattcggcccagagtctgctg
tcggtgatcaacgacctgctggatttgaccaggatcgagtccggcggattcgggacggaa
caggccgattttcagctggaccagctggcgcgggatatcctgcggattcatcagccggtg
gcccagcgcaagggggtgctgttgcagcttgaactggcggacggcatgcccgggctgctg
cgcggggtgccgttgcgtctgaagcaggtgctgcataacctggtgggcaatgcggtcaag
tttaccgatcaggggcgggtcgtcctgtcgatttcccccatcattgtgccggggcagtcg
ttgcgggtccgttttgcggtctgtgacagcggtatcggcatggagccggagaccatcaag
cggatctttgatcccttcagtcaggccgacgagtccatcagccgccgctatggcggtacc
ggtctggggttgaccatctgccgtcgcctgactgagctgatgggaggtacgattgaggtg
gaaagcacaccgggccaggggagctgttttacggtgatcctgccgatgaagacgccgctg
ggggccgtggtccctgccgatgcgccggtcaggcaggacagttttgaaagaaatgcattg
caggttctgctggctgaggatcagccggtgggacggctctatgccacccgtctgctggag
cggctggggcatcgggtaacggcggtggaggatggcaaacaggcgattgaggcctgggag
caaaactgttttgacctgatcctgatggatgtgcagatgcccggcattgacgggacaatg
gccactgcaagtatccggcagcgtgaacaggagggcggcgtgcgaacaccgattattgcc
ctgacggcccatgccttaaccggtgaccgtagtaaactgatggagtgcggttttgatggc
tatgtaccgaaaccgattgatgttgaagggctgctggcggaggtgaaccggctgataaca
ccggctaccgtgctctgcagccggagaggagaacagccatga

DBGET integrated database retrieval system