KEGG   Geobacter lovleyi: Glov_0596Help
Entry
Glov_0596         CDS       T00708                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
glo  Geobacter lovleyi
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:glo00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:glo00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:glo02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
585489..588326
Genome map
AA seq 945 aa AA seqDB search
MFFERRHLRTVAAVLALTMASSLTGCGTTGSSTTPATAVKNVILVIGDGMQLEHERAANN
YLFGNYTEGLAFWKFPYQGQASTWDVTTYNRFATAAGKSVWSASTSTADDSTTFDALLGY
DPAKGGKQPWPLDSTGDKTYLLTGATDSASAGTALATGYKTDDGNVAWKTGDPEDGRLLT
IAEMYRYQKKAAIGVVSTVPFTHATPATFVSHNKSRNNYKDIGYEIINSVKPEVVIGGGH
PNYTTSYMDTRDYNILKASTEYVLAERQTGVDGNSTIAAKATEAVANSKKLFGLFGNSGG
QFDYPVPSNTPGTPSVVRGNIENPSLAEASKAALKVLAQNKNGFFLMIEQGDIDWANHAN
DFKSMVGGVYDLNETVKAIESYVDQPGDDIDWNNTLVIVTSDHGNSYMRLNSAKPLQKGA
LPQQDANSTSNGSYTPSYVYPNGEVTYGTGGHTNELVRVYAKGGKTSLLNSFEGIWYAGT
KIIDNTQLYKVMMSALGLTDQNKQSSLLDKIIAMLPDSLLSILNPKLTTTQLNNAITNGA
RTVTKPGIGSALVPDPKAAGYYYMMTDRGINGDYSYTDPVSGVTTEGKYFPLPAFTPTIV
RVKLDGATIIIDKVIPIVDKDGNYVTGIPNDANDGLAYDSPTAAVGSPLAYNENGLDTED
MQVLPNGDFLVVDEHSPSIVVVEGTTGKVKVRYTPAGKKLTGANYTVKDILPVVMLQRRA
NRGFENLALSSDGKTAYAVMQSPMGQKSDPNYSTAYKNSRVVRIARLDVTDPVNATVTGH
YVVMQSAVADYAKNSAGLTVSNKQTDMKYSAASWLAKDKILLLERANGKAKVFVVDLNFA
TNMLGKSYENTLGPEDIATAGLGLGGLGIVPASVYEAFSTDELPALTLDAADATGTSPSY
EVKFEGMALVGDQLLLANDNDFGIADVTLPTKIWKVSLKRALGSF
NT seq 2838 nt NT seq  +upstreamnt  +downstreamnt
atgtttttcgaacgtaggcatctgaggacggtggcggcggttcttgcgcttaccatggca
agcagcctgaccggctgcggtacgacaggctccagcacgacacctgcaacggcagtaaag
aacgtcattctggtgatcggcgacggcatgcagctggaacatgaacgggcagccaacaat
tacctgttcggcaactacacggaagggcttgccttctggaagttcccctaccaggggcag
gcatccacctgggatgtcaccacctacaacaggtttgcaaccgctgccggcaagagtgtg
tggagtgcatccacttcaaccgcagacgacagcacaacctttgatgcgctgctggggtat
gaccctgccaaagggggcaaacagccctggccgctggacagcaccggcgacaagacctac
ctgctgaccggtgccaccgactccgcctcagccggcacagccctggccaccggctacaag
accgatgacggcaacgtggcctggaagaccggcgaccctgaagacgggcgcctgctgacc
attgccgagatgtaccgctaccagaaaaaggccgccatcggtgtggtttccaccgtgccg
tttacccacgccaccccggccacctttgtcagccacaacaaatcacgcaacaactacaaa
gatatcggctatgagatcatcaactcggtcaagccggaggtggtgatcggcggcggccat
ccgaactacaccaccagctacatggatacccgcgattacaacatcctcaaggcctcgacc
gagtatgtcctggccgagcgtcagaccggtgtggacggtaacagcaccattgccgccaag
gcaaccgaggcagtcgccaacagcaagaagctgttcggcctgttcggcaacagcggcggc
cagtttgattatccggtgccgtccaacacccccggcacgccaagcgtggtacggggtaat
attgaaaacccctccctggccgaggcctccaaggccgccctcaaggtgctcgcccagaac
aagaacggtttctttctgatgattgagcagggggatattgactgggccaaccatgccaac
gacttcaagagcatggtcggcggtgtctatgacctgaacgagaccgtcaaggcgattgag
agctatgttgatcagccgggggatgacatcgactggaacaataccctggtgatcgttacc
tcggaccacggcaacagctatatgcgcctgaacagcgccaagccgctgcaaaagggtgca
ctgccgcaacaggacgccaacagcacctcaaacggcagctataccccctcctatgtctat
cccaacggcgaagtaacctatggcaccggcggacacaccaacgagctggtccgggtctat
gccaaggggggcaagaccagcctgctgaacagttttgaagggatctggtacgcaggcacc
aaaatcatcgacaacacccagctctacaaggtgatgatgtctgccctggggctgaccgac
cagaacaagcagagttcgctgctggacaagatcatcgccatgctgccggacagcctgctc
tcgatcctcaacccgaaactgaccactacccagctgaacaacgccattaccaacggcgcc
aggacggtcaccaaacccggtatcggctctgccctggtgcctgatcccaaggctgccggt
tactactacatgatgaccgaccgtggtatcaacggtgactactcctataccgatccggtc
agcggtgtgaccaccgaaggcaaatatttcccgctgcccgcctttacccccaccattgtc
cgggtcaagcttgacggcgccacaatcatcatcgacaaggtcattccgatcgttgacaag
gacggtaactacgtgaccggtatccccaacgacgccaatgacggcctggcctatgacagt
ccgacagcggcggtgggcagtcccctggcctacaatgaaaacggcctggatacggaagat
atgcaggtgctgcccaacggcgatttcctggtggttgatgaacactcccccagtatcgtg
gtggtggaaggaaccaccggcaaggtcaaggtgcgctacaccccggcaggcaagaagctg
accggcgccaactacacggtcaaggatatcctgcctgtggtcatgctgcagcgccgtgcc
aaccgcggttttgaaaacctggcgctctcctccgacggcaagaccgcctatgcggtcatg
cagagtccgatgggccagaagagcgatccgaactacagcaccgcctacaagaacagccgg
gtggtgcggattgccaggcttgacgtgactgatccggtcaatgcaaccgtgaccggccat
tatgtggtcatgcagagtgccgttgcggactacgccaagaacagcgccggtctgaccgtc
agcaacaagcagaccgacatgaaatattcggccgcctcctggctggccaaagacaagatc
ctgctgctggagcgtgccaacggtaaggccaaggtctttgtggttgacctgaactttgcc
accaacatgctgggtaaatcctatgaaaataccctgggacctgaagatattgccaccgca
ggcctggggctgggcgggctggggatcgtgccggcctcggtctatgaggccttctccacc
gacgaactgccggccctgaccctggatgcggcagatgcaaccggtacgtcacccagctat
gaggtcaagtttgaaggaatggccctggtgggtgatcagcttctgctggccaatgacaac
gacttcgggattgccgatgttaccctgcccaccaagatctggaaggtcagcctgaagcgt
gccctgggcagcttctga

DBGET integrated database retrieval system