KEGG   Geobacter lovleyi: Glov_0688Help
Entry
Glov_0688         CDS       T00708                                 

Definition
(GenBank) Porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
glo  Geobacter lovleyi
Pathway
glo00860  Porphyrin and chlorophyll metabolism
glo01100  Metabolic pathways
glo01110  Biosynthesis of secondary metabolites
glo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:glo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Glov_0688
Enzymes [BR:glo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Glov_0688
Exosome [BR:glo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Glov_0688
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: ACD94414
JGI: Glov0688
UniProt: B3E400
Position
complement(696918..697898)
Genome map
AA seq 326 aa AA seqDB search
MFSSRFRARRIRGKEVFRRMVRETTLSANDLIYPMFSAFGSGIRKEVSSMPGIFQQSIEH
IVAEAKEVHGLGIPAVILFGIPETKDAVGSDAYAEHGIIQETIRAIKREVPGLAVITDVC
LCEYTDHGHCGIIKNGDVDNDATVKLLAREALSHAQAGADMVAPSDMMDGRVAAIRQTLD
NNGFSHIPVMSYAVKYASGYYGPFREAAESTPQFGDRRSYQMDPANRLEALREAQADIEE
GADIIMVKPGLPYLDILRDLRNEYAMPLAVYNVSGEYSMIKGAAANGWIDEERVVMETML
GFKRAGADLIITYHAKDVARWLKGGI
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgttttcatcccgtttcagggctcgccggatccgtggcaaagaggtattccgccggatg
gtacgagagactacactctcagccaacgatctgatttatccgatgttttcagcctttggc
agtggtatccgcaaagaggtttcctccatgccaggtatctttcagcaatccattgagcat
atcgttgccgaggccaaagaagtccatgggctgggcataccggcagtgatcctgttcggc
attcccgagaccaaggatgcggttggaagcgacgcctatgccgagcatggcattatccag
gagacaatccgggcaatcaagcgagaggtgccgggattggcggtcattaccgatgtctgt
ctgtgtgaatacaccgaccatggccactgcggcatcatcaaaaatggtgatgtcgacaac
gatgccacggtcaaactgctggcccgggaagccctttcccacgcccaggccggtgccgac
atggtagccccctccgatatgatggacgggcgggtggctgccattcgccagactctggac
aacaacggcttcagccatatcccggtcatgagctatgcagtcaagtacgcctccggctac
tacgggccgttccgcgaggcagccgaatcaacgcctcaattcggtgaccggcgttcctac
cagatggaccctgccaatcgtctcgaagccctgcgggaagcccaggctgatattgaagaa
ggtgccgatatcatcatggtcaaaccgggacttccctatctggacatcctgcgtgacctg
cgcaatgaatatgccatgccgctggctgtctacaatgtctccggcgaatacagcatgatc
aagggtgcggcggcaaacggctggatcgatgaagagcgggtggtgatggagaccatgctg
ggcttcaagcgggccggggcagatctgatcatcacctatcacgccaaggatgtggcacgc
tggctgaaaggcggcatctag

DBGET integrated database retrieval system