KEGG   Geobacter lovleyi: Glov_0717Help
Entry
Glov_0717         CDS       T00708                                 

Definition
glycoside hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
glo  Geobacter lovleyi
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:glo00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Glov_0717
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Glov_0717
Enzymes [BR:glo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Glov_0717
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(734760..735947)
Genome map
AA seq 395 aa AA seqDB search
MFSCTRRTFLQNSALTGASLLLPGLLGGCAVTRSTAVKTLPPDLQSWPLERKIAQMLLLG
FPGETLEPDSPIDQAIRRYGAGGVVLFDNNIDLGVTGRNITAPAQLKQLTTALQQASELP
LLIAVDQEGGVVARLKDRYGFPATVSAKYLGQQNRLDLTRSSSENLAATLDEYGFNLNLA
PVVDLATNPDNPVIAFKERSFSADPALVAAHAAEFIKSHHRHHILTCLKHFPGHGSSRDD
SHLGLVDVTRYWHENELQPYRDLISQGLCDMVMTAHTFNTAIDPDHPATLSRATIDGILR
KQLGFDGVVVSDDLYMGAIIQHYSYETAVEKAINAGVDLLVVANDKLYSPDIMPRTIELL
LNLVQQGRIPRERIEQASRRIIAMKQRLLKPGNTA
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgttttcctgcacacgccgtacctttcttcaaaacagcgccctgaccggcgcttcattg
ctgctgcccggcctgctgggcggctgtgccgtcacccgcagcacagccgtcaagacattg
ccgccggacctgcagagctggccgctggagcgcaagatcgcccagatgctgttgttgggc
tttcccggcgagaccctggaaccggacagcccgattgatcaggccatccgccgctacggc
gcaggtggggtggtgctgtttgacaacaacatcgaccttggggtaaccggccgcaatatc
acagccccggcccagctgaagcagctgaccaccgccctgcagcaggcctctgaactgccg
ctcttgattgcggtggatcaggaaggaggggtggtcgcccgtttgaaagaccgctacggt
tttcctgccacggtctcggccaaatatctgggacaacagaaccggctggacctgacccgt
tcatccagcgaaaacctcgcggcaacgctggatgaatacggcttcaacctgaacctggcg
ccggtggttgacctggcaacgaacccggataacccggtaatcgcctttaaagagcgcagt
ttctcggctgacccggcgttggtagcggcccatgccgccgagttcatcaagagccaccac
cgccaccatatcctgacctgcctgaagcacttccccggccatggcagctcccgggatgac
tcgcacctgggactggtggatgtgacccgctactggcatgaaaacgagctgcagccctac
cgcgatctgatcagtcaggggctgtgtgatatggtcatgaccgcccacaccttcaatacc
gccatcgacccggaccatcccgccacgctttccagggccaccattgacggcatcctgcgc
aaacagctcggttttgatggcgtggtggtcagcgacgacctctacatgggggcgattatc
cagcattacagctacgaaaccgctgtggagaaggcgatcaatgccggggttgacctgctg
gtggtggcgaatgacaagctctacagccccgatatcatgccccgcaccattgagctgctg
ctgaatctggtacagcagggcagaatcccccgggagcggatcgaacaggccagtcgcagg
atcatcgccatgaaacagcggctcctgaaacccgggaatactgcataa

DBGET integrated database retrieval system