KEGG   Geobacter lovleyi: Glov_0822Help
Entry
Glov_0822         CDS       T00708                                 

Definition
(GenBank) Histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
glo  Geobacter lovleyi
Pathway
glo00340  Histidine metabolism
glo01100  Metabolic pathways
glo01110  Biosynthesis of secondary metabolites
glo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:glo00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Glov_0822
Enzymes [BR:glo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Glov_0822
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: ACD94547
JGI: Glov0822
UniProt: B3E4Y2
Position
844259..845557
Genome map
AA seq 432 aa AA seqDB search
MLFLDINETDFDTRFAAILTRGEETSLQVTEVVRGIIKDIRSSGDDALLEYTNRFDRLGL
ADAAGLEITAAEIEAAVAAVPADDLAALQLAVERVARFHEKQKQQTWLSTEESDILLGQK
VTPLNRVGIYVPGGKASYPSSVIMNAVPAKVAGVREIIMVCPTPGNEINPAVLAAAKLAG
VDRIFRVGGAQAVAALAYGTASIPKVDKITGPGNIYVATAKQLVFGQVGIDMIAGPSEIL
VINDGTGNPAHIAADLLSQAEHDELASSILITTDRGFGEKVAAEVERQLALLSRESIARA
SWDKFGAVIVAGSLAEAAAFSNRIAPEHLELAVADPFGLLPLIDNAGAIFMGHWTPEAAG
DYLAGPNHTLPTGGTARFFSPLSVDDFVKKSSIISFSEQGLKRLGDRIVQIAGLEGLEAH
ARSVSLRLEESK
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
gtgctgtttcttgatatcaatgagactgattttgatacccgttttgctgccatcctgacc
cgtggggaggagacctcgctgcaggtgaccgaggtggtgcgggggattatcaaggatatc
cgcagcagtggcgatgatgccctgctggagtataccaatcgttttgaccggctggggctg
gccgatgctgctggtctggaaataaccgctgccgagatcgaggctgcggttgctgctgtt
cctgctgatgatctggctgccctgcaactggcggttgagcgggtggcccgtttccatgaa
aagcagaagcaacagacctggctatcaaccgaagaaagtgacatcctgctgggccagaag
gtgacaccgctgaaccgggtcggcatctatgtgccgggcggcaaggccagttatcccagc
agcgtgatcatgaacgccgtgccggccaaggtggccggggtgcgggagatcatcatggtc
tgccctacgccgggtaatgagatcaatccggcggtgctggctgcagcaaaacttgccggt
gtggaccggatcttcagggtcggtggagcccaggcagtggctgccctggcctatggtacc
gccagcatccccaaggtggataagatcaccggaccgggcaatatctatgtggcaactgcc
aagcagctggtctttggtcaggtggggattgatatgatcgccggtcccagcgagatcctg
gtgatcaatgacggcaccggcaatccggcccatattgcagcagacctgctgtcacaggct
gagcatgatgagctggcctcctcgatcctgatcaccactgaccgtggttttggcgaaaag
gtcgcagccgaggtggaacgtcagctggcgctgctctcccgcgaatccattgcgcgggca
tcctgggacaaattcggtgcggtgattgtggcaggctcgcttgcagaggctgcagcattc
tctaaccggattgcgccggagcacctcgagctggcggtggctgacccgttcggcctgctg
ccgctgattgacaatgccggggcgatctttatgggacactggacccctgaggcagccgga
gattatctggcaggccccaaccacaccctgcccaccggcggcactgcccgcttcttctca
ccgctgtcggtggatgactttgtcaagaaatcctccattatcagcttctctgagcagggg
ttgaagcggctgggggaccggatcgtgcagattgctgggctggaagggcttgaggcccat
gcgaggtcggtgagtctaaggttggaggagagcaaatga

DBGET integrated database retrieval system