KEGG   Geobacter lovleyi: Glov_1011Help
Entry
Glov_1011         CDS       T00708                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
glo  Geobacter lovleyi
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:glo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Glov_1011
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Glov_1011
Enzymes [BR:glo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Glov_1011
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1050101..1051231
Genome map
AA seq 376 aa AA seqDB search
MRRGLLQQVRRVVIKVGSRVLTVEGGGLDYDAISRLCDEMAGLRQQGIEVILVSSGAVAA
GRDALRSADTTLTIPQKQAAAAVGQPLLMQAYQQACTRHGLVTAQILLTAEDLANRNRFL
NARTTLEALLTAGALPVINENDSVAVAEIKFGDNDNLSALVTSLAEADLLLILTDIEGLY
SANPASDPDAELIPLVRSITREIERMAGGSGSNVGTGGMATKVTAAKKAARFGVPTILAP
GKQPGVITAAVSGQEIGTLFLPATDGLNRRKHWIAYTLRPAGKVLVDAGAQKALVEKGTS
LLPSGITGVEGRFERGRCVRICGPDGTEIARGLADYSSSEIQLIAGHKSAEIEQLLGYRY
GDDVVHRDNLVLMTHS
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagggggctgttgcagcaggtccgcagggtagtaatcaaggtgggcagccgtgtc
ctgaccgttgaggggggcgggcttgattatgacgccatttcccggctgtgtgacgagatg
gccgggctgcgccaacaggggatcgaggtgattctggtctcatccggcgctgttgctgcc
gggcgtgatgccctgcgttcagctgataccaccctgaccataccgcagaagcaggctgct
gctgcggtggggcaaccgcttctgatgcaggcctaccagcaggcctgtacccgccatgga
ctggtgacggcccagatcctgctgacggccgaagatctggccaaccgcaaccgtttcctg
aatgcccggaccacccttgaggcgctgctgactgccggtgccctgccggtgatcaatgag
aacgattccgttgccgtggctgagatcaagtttggcgataatgacaacctctccgccctg
gtgaccagtctggcagaggcagacctgctgctgatcctgaccgatattgaggggctctac
agtgccaaccctgccagtgatcctgatgcagagctgatcccgctggtgcgcagcatcacc
cgcgagatcgagcggatggccggcggcagcggctcaaacgtcggtaccggtggtatggcc
accaaggtgacggcagccaaaaaggcagcccgtttcggggtacccaccattctggcgccg
ggcaaacaaccgggggtgatcactgctgcggtcagtggccaggagatcggcaccctgttc
ctgcctgccactgacggcctgaaccgccgcaagcactggatcgcctataccctgcgtccg
gcaggcaaggtgctggtggatgcaggggcgcagaaggcgttggttgaaaagggtaccagt
ctgctgccatccggcattaccggtgtggaaggccgttttgaacggggtcgctgtgtacgg
atctgtggcccggacgggacagaaattgccagaggattagcggattattccagtagtgag
attcaactgatagcaggtcacaaatctgcggagattgagcagttgctgggctaccgctac
ggtgatgatgtagtacaccgggataatctggtgttgatgacccatagttga

  All links  
No link information was found.   
DBGET integrated database retrieval system