KEGG   Geobacter lovleyi: Glov_1211Help
Entry
Glov_1211         CDS       T00708                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
glo  Geobacter lovleyi
Pathway
glo00260  Glycine, serine and threonine metabolism
glo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
glo01100  Metabolic pathways
glo01110  Biosynthesis of secondary metabolites
glo01130  Biosynthesis of antibiotics
glo01230  Biosynthesis of amino acids
Module
glo_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:glo00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Glov_1211
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Glov_1211
Enzymes [BR:glo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Glov_1211
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP DUF3708
Motif
Other DBs
NCBI-ProteinID: ACD94933
JGI: Glov1211
UniProt: B3E753
Position
complement(1257177..1258367)
Genome map
AA seq 396 aa AA seqDB search
MKQPDKHGHFGIHGGRYVPETLMPALKELEEAYAHYKNDREFKQEFQYYLREYVGRPSPL
YFAEKLTKQLGGAKIYLKREDLNHTGAHKVNNTIGQGLLAKRMKKERVIAETGAGQHGVA
TATIAALFGMQCEVFMGAEDIRRQALNVFRMKLLGATVNPVTAGTATLKDAMNEALRDWV
TNIRTTFYVIGTVAGPHPYPVMVRDFQSVIGIEAKKQHKKVEGRLPDALVACVGGGSNAM
GLFYPFLKDSGVRLIGVEAAGHGIASGAHAAPLCAGRPGILHGQRSYLLQDTHGQVANAH
SISAGLDYPGVGPEHAWLKDTGRAEYVSITDDEALEAFQRLTREEGIMPALESSHAIAHT
LKLAPGMSKDQTIVVCLSGRGDKDIHTVADALGVKF
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaacccgataaacacggccacttcggtatccacggcggacgctatgtgcctgaa
accctgatgcctgccctgaaggagctggaagaggcctatgctcactataagaatgaccgc
gaatttaagcaggagtttcagtactacctgcgggaatatgtgggccgtccttcgccgctc
tactttgccgagaaactgaccaaacagcttggcggcgcgaagatctacctgaagcgtgaa
gacctgaaccataccggagcccacaaggtcaacaacaccatcggccagggactgcttgcc
aaacggatgaaaaaagagcgggtgatcgccgagaccggtgccggtcagcacggcgtggcc
accgccaccattgccgccctgttcggcatgcagtgcgaggtgttcatgggtgctgaggat
atccggcgtcaggcactgaacgtcttccggatgaagctgctgggggccaccgtcaatccg
gtgactgccggcactgccaccctcaaggatgccatgaacgaggcgctgcgggactgggtt
accaacatccgtaccacgttttatgtgatcggcaccgtagccggtccccatccctacccg
gtgatggtgcgtgactttcagtcggtgatcggcattgaggccaagaagcagcacaagaag
gtcgaaggccgcctgccggatgccctggtggcctgcgttggcggcggcagtaacgccatg
gggctgttctaccccttcctgaaggatagcggcgtccgcctgatcggtgttgaggcagcc
gggcacggcattgcctccggtgcccatgcggcgccactctgcgccggtcgccccggtatc
ctgcatggtcagcgcagctacctgctgcaggacacccacggacaggtcgccaatgcccac
tccatttccgccggcctggactaccccggcgtcggcccggaacatgcctggctcaaggac
accggccgggccgagtatgtctcgatcaccgacgatgaggcactggaggcgttccagcgt
ctgacccgtgaagaagggatcatgccggccctggaatcctcccacgccatcgcccacacc
ctcaaactggctcccggcatgtccaaggaccagaccattgtggtctgtctctcaggtcgt
ggcgacaaggatatccataccgttgccgatgccttgggcgtaaaattttaa

DBGET integrated database retrieval system