KEGG   Geobacter lovleyi: Glov_1213Help
Entry
Glov_1213         CDS       T00708                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
glo  Geobacter lovleyi
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:glo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Glov_1213
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Glov_1213
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Glov_1213
Enzymes [BR:glo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Glov_1213
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1259051..1260406)
Genome map
AA seq 451 aa AA seqDB search
MQTKIILPEDKLPTQWYNIIPDLPGPLAPVISPRTGEPVTPEELLAIFPPAILEQEMSNQ
RWIDIPEQVRDIYTMWRPSPMFRAHRLEKALGTPAKIYYKYEGVSPAGSHKPNSAIPQAF
YNKQAGIKRLATETGAGQWGSSLSLACSLFGLECTVYMVKVSYFQKPYRKSMMQMWGATV
YPSPSEMTEAGRAALAENPDSNGSLGLAISEAVEDAATHNDTNYALGSVLNHVCMHQTVI
GLEALEQFKMVGDYPDVVIACCGGGSNFAGLAFPFLSEKANGKKVRCLAVEPASCPTLTK
GVYDFDYGDTAKLGPIAKMYTLGHDFMPPGIHAGGLRYHGESPLVSQLYAAGLIEARSLM
QTACFEGALLFAKNEGIVPAPESSHAVRAAIDEALLAKEEGKERTILFNLSGHGFMDMTA
YDNYLAGNLEDYEYPAEMVQESLKHLPKVKL
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgcagacaaagataattttgcccgaggataaactccccacccaatggtacaacatcatc
cctgacctgccaggtccgctggcaccggttatctccccacgtaccggagagccggtcacc
ccggaagagctgctggcgatctttccgcctgccattctggagcaggagatgtccaatcag
cgctggatcgacatccctgagcaggtgcgtgacatctataccatgtggcggccatccccg
atgttccgggctcaccgcctggaaaaggcgctgggcacgccggccaagatctactacaag
tacgaaggggtctcaccggccggctcacacaagcctaactcggctatcccccaggccttt
tacaacaagcaggccgggatcaagcggctggccaccgagaccggcgccggtcaatggggc
agttccctgtcactggcctgttccctgttcggtctggaatgtacggtctacatggtcaag
gtttcctacttccagaagccgtaccgcaaatccatgatgcagatgtggggcgccacggtg
tacccctccccctctgaaatgaccgaggcaggccgcgctgctctggccgaaaacccggac
tccaacggcagcctcggactggccatctctgaggcggtggaggatgccgctacccacaat
gataccaactatgccctgggcagcgtgctgaaccatgtctgcatgcatcagaccgtgatc
ggcctggaggcgctggagcagttcaagatggtgggagactacccggatgtggtgatcgcc
tgctgcggcggcggctccaacttcgccggtctggccttcccgttcctgtctgaaaaggcc
aatggcaaaaaggtacgctgcctggcggtggaaccggcctcctgccctaccctgaccaaa
ggtgtctatgactttgactacggcgacaccgccaagctgggaccgattgccaagatgtac
accctgggccatgacttcatgccgcccggcatccatgccggtggtctgcgctaccacggc
gagtctccgctggtttcccaactctatgcagccggcctgatcgaggcccgttccctgatg
cagaccgcctgctttgaaggggccctgctgtttgccaagaacgaggggattgtaccggcg
ccggaatcatcccacgccgtcagggcagccattgatgaggcgctgctggccaaggaagag
ggcaaggaacggaccatcctgttcaacctgtccggccacggcttcatggatatgaccgcc
tatgacaactacctggccggcaacctggaagactacgagtatccggcagagatggtgcag
gagtcattaaagcatctgccgaaggtgaaactctag

DBGET integrated database retrieval system