KEGG   Geobacter lovleyi: Glov_1238Help
Entry
Glov_1238         CDS       T00708                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
glo  Geobacter lovleyi
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:glo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Glov_1238
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Glov_1238
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Glov_1238
Enzymes [BR:glo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Glov_1238
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1285626..1286423)
Genome map
AA seq 265 aa AA seqDB search
MKSRIHNRFTQLHKQGGKALVTFITAGDPDLATTAALLPRMAEAGADIIELGIPFSDPMA
DGPTIQRASERALAQGVTLEAVLAMVSQVREQVSAPIVLMGYSNPIYSYGWQRFAQDAVQ
AGIDGLLLVDLPPEEAGELLPAARAAGLEIIFLLTPTSDATRIKQVSRCGSGFLYYVTVT
GVTGARQSVSTSLEHELQTVRNTIRLPVVAGFGISTPEQAAQVAAAADGVVVGSAIVKLF
EQYQGEPLQTEVTGLIRSLKRAITP
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagccgtattcacaaccgcttcacccaattacacaagcagggcggcaaggccctg
gtcacctttatcaccgccggggaccccgatctggccaccacagcagccctgctgccgcgc
atggcagaggccggtgccgacatcattgaactcggcatcccattttccgacccgatggct
gacggccccaccattcagcgtgcctcggagcgggctctggctcagggtgtcaccctcgag
gcggtccttgcaatggtcagccaggtcagagagcaggtttcggcaccgattgtgctgatg
ggctacagcaatccgatctattcctatggctggcagcgctttgcccaggatgccgtgcag
gcaggtattgatggtctgctgctggttgatctgccaccggaagaggctggtgaactgctg
cctgcagccagggcagccggacttgagatcatcttcctgctgacccccacctcggatgcg
acccggatcaagcaggtcagccgctgtggcagcggttttctctattatgtaacggttacc
ggtgttaccggtgcccggcaatccgtctccaccagccttgagcatgaactgcagacggta
cgcaacaccatcaggctcccggttgtggccggcttcggtatttccaccccggaacaggcg
gcccaggtggcagccgccgccgacggcgtcgtggtcggcagtgccattgtcaaactgttt
gaacagtaccagggagagccgttgcaaaccgaagtaaccggattgatcagatcattaaaa
cgtgccattacgccgtaa

DBGET integrated database retrieval system