KEGG   Geobacter lovleyi: Glov_1248Help
Entry
Glov_1248         CDS       T00708                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
glo  Geobacter lovleyi
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:glo03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1296116..1296718
Genome map
AA seq 200 aa AA seqDB search
MIALLTGQIAHKSPDHVILDVHGVGYRVMIPFSTYYELPEEGQATLHIHTSVREDAILLY
GFRTRTEKSFFQLLISVSGIGPKLARDILSNIQPPQLAAALQQGDLHKLSAIPGIGKKTA
ERLVLELKDKAGKLDSGSIPAGDAVGRSLPAGSVLDDVSSALVNLGYKDPQVRKVLAELD
CAGSASVEEVLKQALKILMK
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgattgctcttttaaccggtcagatagcccacaagtcaccggaccatgtcatccttgat
gttcacggggtcggctaccgggtcatgatccctttctccacctactatgagctgcctgaa
gaggggcaggccaccctgcatatccacaccagtgtgcgggaggatgccatcctgctttac
ggctttcgtacccgcacggaaaagtcttttttccagttgctgatctcggtctccggcatc
ggtcccaagctggctcgggacatcctttcaaatatccagccacctcagctggctgctgcc
ttgcaacagggtgatctgcacaaactgtccgccattcccggcatcggcaagaagactgct
gaacgtctggtgctggagttgaaggacaaggcaggcaagctggatagcggcagcatcccg
gcgggtgacgcggtgggacggtcactgcctgcaggcagtgtcctggacgatgtttcttct
gcgctggtaaatttggggtacaaggatccgcaggtcaggaaggtgctggccgagcttgat
tgtgcaggatcggcttctgttgaagaggttctgaaacaggcgttgaagattctgatgaaa
tag

DBGET integrated database retrieval system