KEGG   Geobacter lovleyi: Glov_1263Help
Entry
Glov_1263         CDS       T00708                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
glo  Geobacter lovleyi
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:glo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Glov_1263
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Glov_1263
   00052 Galactose metabolism
    Glov_1263
   00500 Starch and sucrose metabolism
    Glov_1263
   00520 Amino sugar and nucleotide sugar metabolism
    Glov_1263
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Glov_1263
   00524 Butirosin and neomycin biosynthesis
    Glov_1263
Enzymes [BR:glo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Glov_1263
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1312443..1313354
Genome map
AA seq 303 aa AA seqDB search
MVDGASGYIGIDIGGTNLRGALVRPGGEVMARFRSKSAIEGGADSFLMRLTEEIDRLIVE
ARVSGLQVSGVGVGVPGLIGSDGVIHSSVNLRPLEGMNLSRSLEDRLGIPVISANDANLI
ALGEAWAGAGQGMRSLMVITIGTGLGSGLILDGKLWTGAGGFAAEFGHLTVEPEGIPCPC
GNRGCLEQYVSAAALSRYGRGKTPEVLALLAGEGDTDACAAFETLGYWLGTALAGLVNTL
NLEGVIIGGGVSASFDLFAPAVLQTLKQRAFPRMVAALKLCQAALGDDAGLVGGALLAAG
KSF
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
gtggttgatggggcatccggctatataggcattgatattggaggaacaaacctgcgcggt
gcgctggtgcggccagggggcgaggtgatggcccgcttcaggtcgaagagtgccattgag
ggcggggcagattctttcctgatgcgcctgacagaggaaattgaccggctgatcgttgaa
gcccgagtttccggtctgcaggtcagtggtgtcggtgtcggtgtgcctggtctgatcgga
agcgatggtgtcatccattcatccgtaaacctgcggccgctggaggggatgaatctgtcc
cgttcactggaggaccggctgggaataccggtgatatcggccaatgatgccaacctgatc
gccctgggtgaggcctgggccggtgccggacaaggcatgcgctcgctgatggtgataacc
attggaaccggattgggaagtggtttgatacttgatggcaaactctggacaggcgctggt
ggttttgccgctgaattcggacatctgaccgttgagccggaagggattccctgtccctgt
ggtaaccgcggttgtctggaacagtatgtatcggcagctgccctttcccggtatggccgg
ggtaagacaccggaagtcctggccctgctggccggggagggcgacactgatgcctgtgcc
gcattcgaaaccctcggttactggctggggaccgcccttgccggtttggtcaatactctg
aatctcgagggagttatcatcggcggtggtgtctcggccagctttgatctgtttgccccg
gccgtgctgcagacactcaaacagcgcgccttcccccggatggtggcagcgttgaagctc
tgtcaggcagctctgggggatgatgccggacttgtgggaggggcgttgctggctgcagga
aagagtttctag

DBGET integrated database retrieval system