KEGG   Geobacter lovleyi: Glov_1610Help
Entry
Glov_1610         CDS       T00708                                 

Definition
hypothetical protein
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
glo  Geobacter lovleyi
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:glo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Glov_1610
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Glov_1610
  Amino acid metabolism
   00310 Lysine degradation
    Glov_1610
Enzymes [BR:glo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Glov_1610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1705949..1707205
Genome map
AA seq 418 aa AA seqDB search
MEIRIPTAGESVVEALLAKWHKPDGSMVLKDDAICEIETDKITMDIYAEVSGRLVIHVQA
GTTLPVGTVVGRILEADPQAEDQLAVTATGAAGSADAPTSPAVRQALRQQGRTAAQLAGS
GPGGRILMNDLKRTDTPEPPAPALPAALHAMLVKSEETPVYRASGCWKPARPAGDQNTEK
ATEAGPDPQAAPGEERIRISPLRKRISERLLQARHQTATLTTFNEVDMGALQALRTNYKL
AGQPVGLLPFFVRATIEALQAYPAVNARIDGDEIVYYHVQHLGIAVSSEKGLMVPVLRDA
GQLGLWEINEGIAGLVQKIRANQLAIADLEGGTFTISNGGTYGSMLSTPLINPPQSGVLG
MHAIQHRPVARNGQVVIRPMMYLALSYDHRLIDGREAVGFLKLIKERLENTGWLAGLN
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggagatccgtatcccgacagcaggtgagtctgtggttgaggcgctgctggccaaatgg
cacaagccggatggtagcatggttttgaaggatgatgcgatttgtgagattgagaccgat
aagattaccatggatatctatgcagaggtttccggccgcctggtaattcacgttcaggct
ggtacaaccctgccggtgggcaccgtggttggccggattctcgaagcagatccgcaggca
gaggatcaactggctgttacagcaacaggggcggctggatcagcggatgcaccaacctct
ccggcagtgcggcaggcgttacggcaacaaggtcgaactgccgcgcaactggcaggtagc
ggccctggcggccggatactgatgaacgatctgaaacggacggatacaccggaacctcca
gcgccagcgcttccggctgctctgcacgcgatgctggttaagtctgaggaaacaccggtg
tatcgggcttcaggctgctggaaacctgctcgaccggccggagatcaaaacactgaaaaa
gccacagaagccgggcctgatccacaggctgcgccaggtgaagagcggatacggatctcc
ccgctacgcaagcggatctctgagcggctgctgcaggctcgtcaccagaccgccacgttg
accacctttaacgaggttgatatgggggcattgcaggccttgcgcacaaattataagctg
gccggtcagccggtcggcttgctgccgttctttgtcagggctacgattgaggcattacag
gcttatccggcagttaatgcgcggattgatggtgatgagattgtgtattaccatgttcag
catctgggtattgctgtctcctctgaaaaagggctgatggtgccggtgctgcgcgatgca
ggtcagctgggcttgtgggagattaatgagggcatagcgggtcttgtgcagaagatcaga
gccaaccagctggccattgccgacctggaaggtggaacctttaccatcagcaatggcggc
acctatggttccatgctctcgaccccccttattaatccaccccagagtggtgtgttggga
atgcacgccatccagcaccggccggtggcacggaatggtcaggtggtgatacgtccgatg
atgtatctggccttgtcctatgaccatcgcctgattgatggcagggaggcggtcgggttt
cttaagctgatcaaggagcggttggagaacactggctggttggctggactaaactga

DBGET integrated database retrieval system