KEGG   Geobacter lovleyi: Glov_1610Help
Entry
Glov_1610         CDS       T00708                                 

Definition
hypothetical protein
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
glo  Geobacter lovleyi
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:glo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Glov_1610
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Glov_1610
  Amino acid metabolism
   00310 Lysine degradation
    Glov_1610
Enzymes [BR:glo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Glov_1610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1705949..1707205
Genome map
AA seq 418 aa AA seqDB search
MEIRIPTAGESVVEALLAKWHKPDGSMVLKDDAICEIETDKITMDIYAEVSGRLVIHVQA
GTTLPVGTVVGRILEADPQAEDQLAVTATGAAGSADAPTSPAVRQALRQQGRTAAQLAGS
GPGGRILMNDLKRTDTPEPPAPALPAALHAMLVKSEETPVYRASGCWKPARPAGDQNTEK
ATEAGPDPQAAPGEERIRISPLRKRISERLLQARHQTATLTTFNEVDMGALQALRTNYKL
AGQPVGLLPFFVRATIEALQAYPAVNARIDGDEIVYYHVQHLGIAVSSEKGLMVPVLRDA
GQLGLWEINEGIAGLVQKIRANQLAIADLEGGTFTISNGGTYGSMLSTPLINPPQSGVLG
MHAIQHRPVARNGQVVIRPMMYLALSYDHRLIDGREAVGFLKLIKERLENTGWLAGLN
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggagatccgtatcccgacagcaggtgagtctgtggttgaggcgctgctggccaaatgg
cacaagccggatggtagcatggttttgaaggatgatgcgatttgtgagattgagaccgat
aagattaccatggatatctatgcagaggtttccggccgcctggtaattcacgttcaggct
ggtacaaccctgccggtgggcaccgtggttggccggattctcgaagcagatccgcaggca
gaggatcaactggctgttacagcaacaggggcggctggatcagcggatgcaccaacctct
ccggcagtgcggcaggcgttacggcaacaaggtcgaactgccgcgcaactggcaggtagc
ggccctggcggccggatactgatgaacgatctgaaacggacggatacaccggaacctcca
gcgccagcgcttccggctgctctgcacgcgatgctggttaagtctgaggaaacaccggtg
tatcgggcttcaggctgctggaaacctgctcgaccggccggagatcaaaacactgaaaaa
gccacagaagccgggcctgatccacaggctgcgccaggtgaagagcggatacggatctcc
ccgctacgcaagcggatctctgagcggctgctgcaggctcgtcaccagaccgccacgttg
accacctttaacgaggttgatatgggggcattgcaggccttgcgcacaaattataagctg
gccggtcagccggtcggcttgctgccgttctttgtcagggctacgattgaggcattacag
gcttatccggcagttaatgcgcggattgatggtgatgagattgtgtattaccatgttcag
catctgggtattgctgtctcctctgaaaaagggctgatggtgccggtgctgcgcgatgca
ggtcagctgggcttgtgggagattaatgagggcatagcgggtcttgtgcagaagatcaga
gccaaccagctggccattgccgacctggaaggtggaacctttaccatcagcaatggcggc
acctatggttccatgctctcgaccccccttattaatccaccccagagtggtgtgttggga
atgcacgccatccagcaccggccggtggcacggaatggtcaggtggtgatacgtccgatg
atgtatctggccttgtcctatgaccatcgcctgattgatggcagggaggcggtcgggttt
cttaagctgatcaaggagcggttggagaacactggctggttggctggactaaactga

DBGET integrated database retrieval system